Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1896875..1897057 | Replicon | chromosome |
Accession | NZ_AP023034 | ||
Organism | Staphylococcus aureus strain TPS3156 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | HZ307_RS09180 | Protein ID | WP_001801861.1 |
Coordinates | 1896875..1896970 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1896998..1897057 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HZ307_RS09140 | 1892535..1893161 | + | 627 | WP_000669046.1 | hypothetical protein | - |
HZ307_RS09145 | 1893202..1893546 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
HZ307_RS09150 | 1893644..1894195 | + | 552 | WP_000414205.1 | hypothetical protein | - |
HZ307_RS09155 | 1894413..1895054 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
HZ307_RS09160 | 1895168..1895353 | - | 186 | WP_000809857.1 | hypothetical protein | - |
HZ307_RS09165 | 1895355..1895531 | - | 177 | WP_000375476.1 | hypothetical protein | - |
HZ307_RS09170 | 1895542..1895925 | - | 384 | WP_000070811.1 | hypothetical protein | - |
HZ307_RS09175 | 1896529..1896672 | - | 144 | WP_001549059.1 | transposase | - |
HZ307_RS09180 | 1896875..1896970 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1896998..1897057 | - | 60 | - | - | Antitoxin |
HZ307_RS09185 | 1897093..1897194 | + | 102 | WP_001791893.1 | hypothetical protein | - |
HZ307_RS09190 | 1897172..1897348 | - | 177 | Protein_1807 | transposase | - |
HZ307_RS09195 | 1897542..1897919 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA | 1870849..1930146 | 59297 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T36671 WP_001801861.1 NZ_AP023034:1896875-1896970 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T36671 NZ_AP023034:1896875-1896970 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT36671 NZ_AP023034:c1897057-1896998 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|