Detailed information of TA system TA036128

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 46817..47056
• Replicon: plasmid pTHO-015-1
• Accession: NZ_AP022550
• Organism: Escherichia coli strain THO-015

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: A0A762TWR7
• Locus tag: JLF69_RS24705
• Protein ID: WP_023144756.1
• Coordinates: 46922..47056 (+)
• Length: 45 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	46817..46877 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
JLF69_RS24675	42608..43168	+	561	WP_000139341.1	fertility inhibition protein FinO	-
JLF69_RS24680	43299..43511	+	213	WP_013023861.1	hypothetical protein	-
JLF69_RS24685	44070..44495	+	426	WP_000422741.1	IS66 family insertion sequence hypothetical protein	-
JLF69_RS24690	44492..44842	+	351	WP_000624722.1	IS66 family insertion sequence element accessory protein TnpB	-
JLF69_RS24695	44873..46486	+	1614	WP_000080195.1	IS66-like element ISEc23 family transposase	-
JLF69_RS24700	46564..46850	+	287	Protein_53	DUF2726 domain-containing protein	-
-	46817..46877	-	61	NuclAT_2	-	Antitoxin
-	46817..46877	-	61	NuclAT_2	-	Antitoxin
-	46817..46877	-	61	NuclAT_2	-	Antitoxin
-	46817..46877	-	61	NuclAT_2	-	Antitoxin
JLF69_RS24705	46922..47056	+	135	WP_023144756.1	type I toxin-antitoxin system Hok family toxin	Toxin
JLF69_RS24710	47353..47607	+	255	WP_000083850.1	replication regulatory protein RepA	-
JLF69_RS24715	47713..47847	+	135	Protein_56	protein CopA/IncA	-
JLF69_RS24720	47844..47918	+	75	WP_031943482.1	RepA leader peptide Tap	-
JLF69_RS24725	47911..48768	+	858	WP_001617855.1	incFII family plasmid replication initiator RepA	-
JLF69_RS24730	49708..50361	+	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
JLF69_RS24735	50454..50711	+	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
JLF69_RS24740	50644..51045	+	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-
JLF69_RS24745	51294..51709	+	416	Protein_62	IS1 family transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaCTX-M-27 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5	-	1..88121	88121
	-	inside	IScluster/Tn	blaCTX-M-27 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5	-	44070..72509	28439

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-44)

Sequences

Toxin

Protein

• Length: 45 a.a.
• Molecular weight: 4896.90 Da
• Isoelectric Point: 7.7209

>T36128 WP_023144756.1 NZ_AP022550:46922-47056 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Nucleotide

• Length: 135 bp

>T36128 NZ_AP022550:46922-47056 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA

Antitoxin

Nucleotide

• Length: 61 bp

>AT36128 NZ_AP022550:c46877-46817 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A762TWR7

Antitoxin