Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 19320..19562 | Replicon | plasmid pTHO-015-1 |
| Accession | NZ_AP022550 | ||
| Organism | Escherichia coli strain THO-015 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | JLF69_RS24550 | Protein ID | WP_001312861.1 |
| Coordinates | 19404..19562 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 19320..19360 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JLF69_RS24530 | 14515..16473 | + | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
| JLF69_RS24535 | 16528..16962 | + | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| JLF69_RS24540 | 16959..17678 | + | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
| - | 17690..17876 | + | 187 | NuclAT_0 | - | - |
| - | 17690..17876 | + | 187 | NuclAT_0 | - | - |
| - | 17690..17876 | + | 187 | NuclAT_0 | - | - |
| - | 17690..17876 | + | 187 | NuclAT_0 | - | - |
| JLF69_RS24545 | 17924..19293 | + | 1370 | WP_085947770.1 | IS3-like element IS150 family transposase | - |
| - | 19320..19360 | + | 41 | NuclAT_1 | - | Antitoxin |
| - | 19320..19360 | + | 41 | NuclAT_1 | - | Antitoxin |
| - | 19320..19360 | + | 41 | NuclAT_1 | - | Antitoxin |
| - | 19320..19360 | + | 41 | NuclAT_1 | - | Antitoxin |
| JLF69_RS24550 | 19404..19562 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| JLF69_RS24555 | 20005..20340 | + | 336 | WP_013023876.1 | hypothetical protein | - |
| JLF69_RS24560 | 20253..20459 | + | 207 | WP_000275859.1 | hypothetical protein | - |
| JLF69_RS24565 | 20484..20771 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| JLF69_RS24570 | 20890..21711 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| JLF69_RS24575 | 22008..22610 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| JLF69_RS24580 | 22941..23324 | + | 384 | WP_001151566.1 | relaxosome protein TraM | - |
| JLF69_RS24585 | 23458..24135 | + | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| JLF69_RS24590 | 24223..24450 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-27 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 | - | 1..88121 | 88121 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T36124 WP_001312861.1 NZ_AP022550:19404-19562 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T36124 NZ_AP022550:19404-19562 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 41 bp
>AT36124 NZ_AP022550:19320-19360 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|