Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 60407..60646 | Replicon | plasmid pTHO-006-2 |
| Accession | NZ_AP022535 | ||
| Organism | Escherichia coli strain THO-006 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | JLF32_RS25265 | Protein ID | WP_023144756.1 |
| Coordinates | 60512..60646 (+) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 60407..60467 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JLF32_RS25235 | 56198..56758 | + | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| JLF32_RS25240 | 56889..57101 | + | 213 | WP_013023861.1 | hypothetical protein | - |
| JLF32_RS25245 | 57660..58085 | + | 426 | WP_000422741.1 | IS66 family insertion sequence hypothetical protein | - |
| JLF32_RS25250 | 58082..58432 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| JLF32_RS25255 | 58463..60076 | + | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| JLF32_RS25260 | 60154..60440 | + | 287 | Protein_68 | DUF2726 domain-containing protein | - |
| - | 60407..60467 | - | 61 | NuclAT_2 | - | Antitoxin |
| - | 60407..60467 | - | 61 | NuclAT_2 | - | Antitoxin |
| - | 60407..60467 | - | 61 | NuclAT_2 | - | Antitoxin |
| - | 60407..60467 | - | 61 | NuclAT_2 | - | Antitoxin |
| JLF32_RS25265 | 60512..60646 | + | 135 | WP_023144756.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| JLF32_RS25270 | 60943..61197 | + | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| JLF32_RS25275 | 61303..61437 | + | 135 | Protein_71 | protein CopA/IncA | - |
| JLF32_RS25280 | 61434..61508 | + | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| JLF32_RS25285 | 61501..62358 | + | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
| JLF32_RS25290 | 63060..63200 | + | 141 | WP_001333237.1 | hypothetical protein | - |
| JLF32_RS25295 | 63298..63951 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| JLF32_RS25300 | 64044..64301 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| JLF32_RS25305 | 64234..64635 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| JLF32_RS25310 | 64884..65299 | + | 416 | Protein_78 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 / mph(A) / sul1 / qacE / aadA5 / dfrA17 | - | 1..101966 | 101966 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T36004 WP_023144756.1 NZ_AP022535:60512-60646 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
>T36004 NZ_AP022535:60512-60646 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
Antitoxin
Download Length: 61 bp
>AT36004 NZ_AP022535:c60467-60407 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|