Detailed information of TA system TA036004

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 60407..60646
• Replicon: plasmid pTHO-006-2
• Accession: NZ_AP022535
• Organism: Escherichia coli strain THO-006

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: A0A762TWR7
• Locus tag: JLF32_RS25265
• Protein ID: WP_023144756.1
• Coordinates: 60512..60646 (+)
• Length: 45 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	60407..60467 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
JLF32_RS25235	56198..56758	+	561	WP_000139341.1	fertility inhibition protein FinO	-
JLF32_RS25240	56889..57101	+	213	WP_013023861.1	hypothetical protein	-
JLF32_RS25245	57660..58085	+	426	WP_000422741.1	IS66 family insertion sequence hypothetical protein	-
JLF32_RS25250	58082..58432	+	351	WP_000624722.1	IS66 family insertion sequence element accessory protein TnpB	-
JLF32_RS25255	58463..60076	+	1614	WP_000080195.1	IS66-like element ISEc23 family transposase	-
JLF32_RS25260	60154..60440	+	287	Protein_68	DUF2726 domain-containing protein	-
-	60407..60467	-	61	NuclAT_2	-	Antitoxin
-	60407..60467	-	61	NuclAT_2	-	Antitoxin
-	60407..60467	-	61	NuclAT_2	-	Antitoxin
-	60407..60467	-	61	NuclAT_2	-	Antitoxin
JLF32_RS25265	60512..60646	+	135	WP_023144756.1	type I toxin-antitoxin system Hok family toxin	Toxin
JLF32_RS25270	60943..61197	+	255	WP_000083850.1	replication regulatory protein RepA	-
JLF32_RS25275	61303..61437	+	135	Protein_71	protein CopA/IncA	-
JLF32_RS25280	61434..61508	+	75	WP_031943482.1	RepA leader peptide Tap	-
JLF32_RS25285	61501..62358	+	858	WP_001617855.1	incFII family plasmid replication initiator RepA	-
JLF32_RS25290	63060..63200	+	141	WP_001333237.1	hypothetical protein	-
JLF32_RS25295	63298..63951	+	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
JLF32_RS25300	64044..64301	+	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
JLF32_RS25305	64234..64635	+	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-
JLF32_RS25310	64884..65299	+	416	Protein_78	IS1 family transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 / mph(A) / sul1 / qacE / aadA5 / dfrA17	-	1..101966	101966

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-44)

Sequences

Toxin

Protein

• Length: 45 a.a.
• Molecular weight: 4896.90 Da
• Isoelectric Point: 7.7209

>T36004 WP_023144756.1 NZ_AP022535:60512-60646 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Nucleotide

• Length: 135 bp

>T36004 NZ_AP022535:60512-60646 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA

Antitoxin

Nucleotide

• Length: 61 bp

>AT36004 NZ_AP022535:c60467-60407 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A762TWR7

Antitoxin