Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 110175..110428 | Replicon | plasmid pTHO-006-1 |
Accession | NZ_AP022534 | ||
Organism | Escherichia coli strain THO-006 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | A0A148HBD8 |
Locus tag | JLF32_RS24910 | Protein ID | WP_001336447.1 |
Coordinates | 110279..110428 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 110175..110231 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JLF32_RS24880 | 106087..106833 | + | 747 | WP_113318688.1 | conjugal transfer pilus acetylase TraX | - |
JLF32_RS24885 | 106888..107445 | + | 558 | WP_000139329.1 | fertility inhibition protein FinO | - |
JLF32_RS24890 | 107597..107800 | + | 204 | WP_001336517.1 | hypothetical protein | - |
JLF32_RS24895 | 108542..109003 | + | 462 | WP_019842128.1 | thermonuclease family protein | - |
JLF32_RS24900 | 109106..109490 | + | 385 | Protein_143 | hypothetical protein | - |
JLF32_RS24905 | 109643..110080 | + | 438 | WP_000872609.1 | hypothetical protein | - |
- | 110175..110231 | - | 57 | NuclAT_2 | - | Antitoxin |
- | 110175..110231 | - | 57 | NuclAT_2 | - | Antitoxin |
- | 110175..110231 | - | 57 | NuclAT_2 | - | Antitoxin |
- | 110175..110231 | - | 57 | NuclAT_2 | - | Antitoxin |
JLF32_RS24910 | 110279..110428 | + | 150 | WP_001336447.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
JLF32_RS24915 | 110713..110970 | + | 258 | WP_000084404.1 | replication regulatory protein RepA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..111171 | 111171 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5572.69 Da Isoelectric Point: 8.7678
>T35998 WP_001336447.1 NZ_AP022534:110279-110428 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T35998 NZ_AP022534:110279-110428 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATACCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 57 bp
>AT35998 NZ_AP022534:c110231-110175 [Escherichia coli]
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|