Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 25583..25852 | Replicon | plasmid pTHO-006-1 |
| Accession | NZ_AP022534 | ||
| Organism | Escherichia coli strain THO-006 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | JLF32_RS24360 | Protein ID | WP_001312861.1 |
| Coordinates | 25694..25852 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 25583..25648 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JLF32_RS24330 | 21351..21890 | + | 540 | WP_001530505.1 | single-stranded DNA-binding protein | - |
| JLF32_RS24335 | 21952..22185 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
| JLF32_RS24340 | 22251..24209 | + | 1959 | WP_200924004.1 | ParB/RepB/Spo0J family partition protein | - |
| JLF32_RS24345 | 24264..24698 | + | 435 | WP_000845923.1 | conjugation system SOS inhibitor PsiB | - |
| JLF32_RS24350 | 24695..25414 | + | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
| JLF32_RS24355 | 25426..25614 | - | 189 | WP_001336239.1 | hypothetical protein | - |
| - | 25426..25650 | + | 225 | NuclAT_0 | - | - |
| - | 25426..25650 | + | 225 | NuclAT_0 | - | - |
| - | 25426..25650 | + | 225 | NuclAT_0 | - | - |
| - | 25426..25650 | + | 225 | NuclAT_0 | - | - |
| - | 25583..25648 | + | 66 | - | - | Antitoxin |
| JLF32_RS24360 | 25694..25852 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| JLF32_RS24365 | 26146..26301 | + | 156 | WP_163034349.1 | hypothetical protein | - |
| JLF32_RS24370 | 26299..26496 | - | 198 | Protein_37 | hypothetical protein | - |
| JLF32_RS24375 | 26498..26785 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| JLF32_RS24380 | 26905..27726 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| JLF32_RS24385 | 28021..28662 | - | 642 | WP_166687685.1 | transglycosylase SLT domain-containing protein | - |
| JLF32_RS24390 | 28944..29327 | + | 384 | WP_001151538.1 | relaxosome protein TraM | - |
| JLF32_RS24395 | 29514..30203 | + | 690 | WP_016239105.1 | conjugal transfer transcriptional regulator TraJ | - |
| JLF32_RS24400 | 30302..30697 | + | 396 | WP_001309237.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..111171 | 111171 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T35991 WP_001312861.1 NZ_AP022534:25694-25852 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T35991 NZ_AP022534:25694-25852 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT35991 NZ_AP022534:25583-25648 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|