Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4189029..4189287 | Replicon | chromosome |
Accession | NZ_AP022533 | ||
Organism | Escherichia coli strain THO-006 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | JLF32_RS20120 | Protein ID | WP_000809168.1 |
Coordinates | 4189135..4189287 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 4189029..4189086 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JLF32_RS20105 | 4184858..4186117 | - | 1260 | WP_000494928.1 | hypothetical protein | - |
JLF32_RS20110 | 4186246..4187739 | - | 1494 | WP_001443162.1 | sulfatase-like hydrolase/transferase | - |
JLF32_RS20115 | 4187759..4188520 | - | 762 | WP_001274832.1 | hypothetical protein | - |
- | 4189029..4189086 | - | 58 | - | - | Antitoxin |
JLF32_RS20120 | 4189135..4189287 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
JLF32_RS20125 | 4189392..4190522 | - | 1131 | WP_001118465.1 | molecular chaperone DnaJ | - |
JLF32_RS20130 | 4190611..4192527 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
JLF32_RS20135 | 4192899..4193303 | + | 405 | WP_000843687.1 | DUF2541 family protein | - |
JLF32_RS20140 | 4193329..4194042 | + | 714 | WP_001102391.1 | acidic protein MsyB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T35983 WP_000809168.1 NZ_AP022533:4189135-4189287 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
>T35983 NZ_AP022533:4189135-4189287 [Escherichia coli]
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
Antitoxin
Download Length: 58 bp
>AT35983 NZ_AP022533:c4189086-4189029 [Escherichia coli]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|