Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 80445..80678 | Replicon | plasmid pTHO-003-1 |
Accession | NZ_AP022526 | ||
Organism | Escherichia coli strain THO-003 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | JLF28_RS26090 | Protein ID | WP_001312861.1 |
Coordinates | 80520..80678 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 80445..80476 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JLF28_RS26055 | 76566..77063 | + | 498 | WP_042039995.1 | single-stranded DNA-binding protein | - |
JLF28_RS26060 | 77131..77364 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
JLF28_RS26065 | 77392..77589 | + | 198 | Protein_87 | hypothetical protein | - |
JLF28_RS26070 | 77644..78078 | + | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
JLF28_RS26075 | 78075..78794 | + | 720 | WP_001276238.1 | plasmid SOS inhibition protein A | - |
JLF28_RS26080 | 78806..78994 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 78806..79003 | + | 198 | NuclAT_0 | - | - |
- | 78806..79003 | + | 198 | NuclAT_0 | - | - |
- | 78806..79003 | + | 198 | NuclAT_0 | - | - |
- | 78806..79003 | + | 198 | NuclAT_0 | - | - |
JLF28_RS26085 | 79051..80420 | + | 1370 | WP_085947770.1 | IS3-like element IS150 family transposase | - |
- | 80445..80476 | + | 32 | NuclAT_1 | - | Antitoxin |
- | 80445..80476 | + | 32 | NuclAT_1 | - | Antitoxin |
- | 80445..80476 | + | 32 | NuclAT_1 | - | Antitoxin |
- | 80445..80476 | + | 32 | NuclAT_1 | - | Antitoxin |
JLF28_RS26090 | 80520..80678 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
JLF28_RS26095 | 81011..82624 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
JLF28_RS26100 | 82655..83005 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
JLF28_RS26105 | 83002..83427 | - | 426 | WP_000422741.1 | IS66 family insertion sequence hypothetical protein | - |
JLF28_RS26110 | 84139..84426 | + | 288 | WP_000107535.1 | hypothetical protein | - |
JLF28_RS26115 | 84544..85365 | + | 822 | WP_001234426.1 | DUF945 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..123467 | 123467 | |
- | inside | IScluster/Tn | - | - | 79051..83427 | 4376 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T35940 WP_001312861.1 NZ_AP022526:80520-80678 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T35940 NZ_AP022526:80520-80678 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 32 bp
>AT35940 NZ_AP022526:80445-80476 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|