Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 15883..16153 | Replicon | plasmid pSTN0717-20-1 |
Accession | NZ_AP022483 | ||
Organism | Escherichia coli strain STN0717-20 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | JLE48_RS22820 | Protein ID | WP_001312861.1 |
Coordinates | 15995..16153 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 15883..15946 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JLE48_RS22775 | 11994..12559 | + | 566 | Protein_15 | class I SAM-dependent methyltransferase | - |
JLE48_RS22780 | 12585..12803 | + | 219 | WP_001496291.1 | hypothetical protein | - |
JLE48_RS22785 | 13213..13419 | + | 207 | WP_000275856.1 | hypothetical protein | - |
JLE48_RS22790 | 13445..13984 | + | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
JLE48_RS22795 | 14052..14285 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
JLE48_RS22800 | 14313..14510 | + | 198 | Protein_20 | hypothetical protein | - |
JLE48_RS22805 | 14565..14999 | + | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
JLE48_RS22810 | 14996..15715 | + | 720 | WP_001276238.1 | plasmid SOS inhibition protein A | - |
JLE48_RS22815 | 15727..15915 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 15727..15951 | + | 225 | NuclAT_0 | - | - |
- | 15727..15951 | + | 225 | NuclAT_0 | - | - |
- | 15727..15951 | + | 225 | NuclAT_0 | - | - |
- | 15727..15951 | + | 225 | NuclAT_0 | - | - |
- | 15883..15946 | - | 64 | - | - | Antitoxin |
JLE48_RS22820 | 15995..16153 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
JLE48_RS22825 | 17074..17361 | + | 288 | WP_000107535.1 | hypothetical protein | - |
JLE48_RS22830 | 17479..18300 | + | 822 | WP_001234426.1 | DUF945 domain-containing protein | - |
JLE48_RS22835 | 18597..19199 | - | 603 | WP_013362798.1 | transglycosylase SLT domain-containing protein | - |
JLE48_RS22840 | 19520..19903 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
JLE48_RS22845 | 20090..20779 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(A) / blaCTX-M-55 / qnrS1 / aac(3)-IId / sitABCD | iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA | 1..157329 | 157329 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T35766 WP_001312861.1 NZ_AP022483:15995-16153 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T35766 NZ_AP022483:15995-16153 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT35766 NZ_AP022483:c15946-15883 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|