Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2602214..2602434 Replicon chromosome
Accession NZ_AP022482
Organism Escherichia coli strain STN0717-20

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag JLE48_RS12360 Protein ID WP_000170965.1
Coordinates 2602327..2602434 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2602214..2602280 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JLE48_RS12335 2597493..2598887 - 1395 WP_000086201.1 inverse autotransporter invasin YchO -
JLE48_RS12340 2599072..2599425 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
JLE48_RS12345 2599469..2600164 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
JLE48_RS12350 2600322..2600552 - 231 WP_001146442.1 putative cation transport regulator ChaB -
JLE48_RS12355 2600822..2601922 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2602214..2602280 - 67 - - Antitoxin
JLE48_RS12360 2602327..2602434 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2602747..2602810 - 64 NuclAT_33 - -
- 2602747..2602810 - 64 NuclAT_33 - -
- 2602747..2602810 - 64 NuclAT_33 - -
- 2602747..2602810 - 64 NuclAT_33 - -
- 2602747..2602810 - 64 NuclAT_36 - -
- 2602747..2602810 - 64 NuclAT_36 - -
- 2602747..2602810 - 64 NuclAT_36 - -
- 2602747..2602810 - 64 NuclAT_36 - -
- 2602747..2602810 - 64 NuclAT_39 - -
- 2602747..2602810 - 64 NuclAT_39 - -
- 2602747..2602810 - 64 NuclAT_39 - -
- 2602747..2602810 - 64 NuclAT_39 - -
- 2602747..2602810 - 64 NuclAT_42 - -
- 2602747..2602810 - 64 NuclAT_42 - -
- 2602747..2602810 - 64 NuclAT_42 - -
- 2602747..2602810 - 64 NuclAT_42 - -
- 2602747..2602810 - 64 NuclAT_45 - -
- 2602747..2602810 - 64 NuclAT_45 - -
- 2602747..2602810 - 64 NuclAT_45 - -
- 2602747..2602810 - 64 NuclAT_45 - -
- 2602747..2602810 - 64 NuclAT_48 - -
- 2602747..2602810 - 64 NuclAT_48 - -
- 2602747..2602810 - 64 NuclAT_48 - -
- 2602747..2602810 - 64 NuclAT_48 - -
- 2602748..2602810 - 63 NuclAT_50 - -
- 2602748..2602810 - 63 NuclAT_50 - -
- 2602748..2602810 - 63 NuclAT_50 - -
- 2602748..2602810 - 63 NuclAT_50 - -
- 2602748..2602810 - 63 NuclAT_53 - -
- 2602748..2602810 - 63 NuclAT_53 - -
- 2602748..2602810 - 63 NuclAT_53 - -
- 2602748..2602810 - 63 NuclAT_53 - -
- 2602748..2602810 - 63 NuclAT_56 - -
- 2602748..2602810 - 63 NuclAT_56 - -
- 2602748..2602810 - 63 NuclAT_56 - -
- 2602748..2602810 - 63 NuclAT_56 - -
- 2602749..2602810 - 62 NuclAT_15 - -
- 2602749..2602810 - 62 NuclAT_15 - -
- 2602749..2602810 - 62 NuclAT_15 - -
- 2602749..2602810 - 62 NuclAT_15 - -
- 2602749..2602810 - 62 NuclAT_18 - -
- 2602749..2602810 - 62 NuclAT_18 - -
- 2602749..2602810 - 62 NuclAT_18 - -
- 2602749..2602810 - 62 NuclAT_18 - -
- 2602749..2602810 - 62 NuclAT_21 - -
- 2602749..2602810 - 62 NuclAT_21 - -
- 2602749..2602810 - 62 NuclAT_21 - -
- 2602749..2602810 - 62 NuclAT_21 - -
- 2602749..2602810 - 62 NuclAT_24 - -
- 2602749..2602810 - 62 NuclAT_24 - -
- 2602749..2602810 - 62 NuclAT_24 - -
- 2602749..2602810 - 62 NuclAT_24 - -
- 2602749..2602810 - 62 NuclAT_27 - -
- 2602749..2602810 - 62 NuclAT_27 - -
- 2602749..2602810 - 62 NuclAT_27 - -
- 2602749..2602810 - 62 NuclAT_27 - -
- 2602749..2602810 - 62 NuclAT_30 - -
- 2602749..2602810 - 62 NuclAT_30 - -
- 2602749..2602810 - 62 NuclAT_30 - -
- 2602749..2602810 - 62 NuclAT_30 - -
JLE48_RS12365 2602863..2602970 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2603283..2603348 - 66 NuclAT_32 - -
- 2603283..2603348 - 66 NuclAT_32 - -
- 2603283..2603348 - 66 NuclAT_32 - -
- 2603283..2603348 - 66 NuclAT_32 - -
- 2603283..2603348 - 66 NuclAT_35 - -
- 2603283..2603348 - 66 NuclAT_35 - -
- 2603283..2603348 - 66 NuclAT_35 - -
- 2603283..2603348 - 66 NuclAT_35 - -
- 2603283..2603348 - 66 NuclAT_38 - -
- 2603283..2603348 - 66 NuclAT_38 - -
- 2603283..2603348 - 66 NuclAT_38 - -
- 2603283..2603348 - 66 NuclAT_38 - -
- 2603283..2603348 - 66 NuclAT_41 - -
- 2603283..2603348 - 66 NuclAT_41 - -
- 2603283..2603348 - 66 NuclAT_41 - -
- 2603283..2603348 - 66 NuclAT_41 - -
- 2603283..2603348 - 66 NuclAT_44 - -
- 2603283..2603348 - 66 NuclAT_44 - -
- 2603283..2603348 - 66 NuclAT_44 - -
- 2603283..2603348 - 66 NuclAT_44 - -
- 2603283..2603348 - 66 NuclAT_47 - -
- 2603283..2603348 - 66 NuclAT_47 - -
- 2603283..2603348 - 66 NuclAT_47 - -
- 2603283..2603348 - 66 NuclAT_47 - -
- 2603284..2603350 - 67 NuclAT_49 - -
- 2603284..2603350 - 67 NuclAT_49 - -
- 2603284..2603350 - 67 NuclAT_49 - -
- 2603284..2603350 - 67 NuclAT_49 - -
- 2603284..2603350 - 67 NuclAT_52 - -
- 2603284..2603350 - 67 NuclAT_52 - -
- 2603284..2603350 - 67 NuclAT_52 - -
- 2603284..2603350 - 67 NuclAT_52 - -
- 2603284..2603350 - 67 NuclAT_55 - -
- 2603284..2603350 - 67 NuclAT_55 - -
- 2603284..2603350 - 67 NuclAT_55 - -
- 2603284..2603350 - 67 NuclAT_55 - -
- 2603285..2603348 - 64 NuclAT_14 - -
- 2603285..2603348 - 64 NuclAT_14 - -
- 2603285..2603348 - 64 NuclAT_14 - -
- 2603285..2603348 - 64 NuclAT_14 - -
- 2603285..2603348 - 64 NuclAT_17 - -
- 2603285..2603348 - 64 NuclAT_17 - -
- 2603285..2603348 - 64 NuclAT_17 - -
- 2603285..2603348 - 64 NuclAT_17 - -
- 2603285..2603348 - 64 NuclAT_20 - -
- 2603285..2603348 - 64 NuclAT_20 - -
- 2603285..2603348 - 64 NuclAT_20 - -
- 2603285..2603348 - 64 NuclAT_20 - -
- 2603285..2603348 - 64 NuclAT_23 - -
- 2603285..2603348 - 64 NuclAT_23 - -
- 2603285..2603348 - 64 NuclAT_23 - -
- 2603285..2603348 - 64 NuclAT_23 - -
- 2603285..2603348 - 64 NuclAT_26 - -
- 2603285..2603348 - 64 NuclAT_26 - -
- 2603285..2603348 - 64 NuclAT_26 - -
- 2603285..2603348 - 64 NuclAT_26 - -
- 2603285..2603348 - 64 NuclAT_29 - -
- 2603285..2603348 - 64 NuclAT_29 - -
- 2603285..2603348 - 64 NuclAT_29 - -
- 2603285..2603348 - 64 NuclAT_29 - -
JLE48_RS12370 2603398..2603505 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
JLE48_RS12375 2603654..2604508 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
JLE48_RS12380 2604544..2605353 - 810 WP_001257044.1 invasion regulator SirB1 -
JLE48_RS12385 2605357..2605749 - 393 WP_000200392.1 invasion regulator SirB2 -
JLE48_RS12390 2605746..2606579 - 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T35758 WP_000170965.1 NZ_AP022482:2602327-2602434 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T35758 NZ_AP022482:2602327-2602434 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT35758 NZ_AP022482:c2602280-2602214 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References