Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 4564984..4565206 | Replicon | chromosome |
Accession | NZ_AP022351 | ||
Organism | Escherichia coli strain E138 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | A0A3K0NFU8 |
Locus tag | GR930_RS22085 | Protein ID | WP_000170748.1 |
Coordinates | 4564984..4565091 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 4565148..4565206 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GR930_RS22060 | 4560519..4560707 | - | 189 | WP_001063314.1 | YhjR family protein | - |
GR930_RS22065 | 4560980..4562551 | + | 1572 | WP_001204941.1 | cellulose biosynthesis protein BcsE | - |
GR930_RS22070 | 4562548..4562739 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
GR930_RS22075 | 4562736..4564415 | + | 1680 | Protein_4296 | cellulose biosynthesis protein BcsG | - |
GR930_RS22080 | 4564501..4564608 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
GR930_RS22085 | 4564984..4565091 | - | 108 | WP_000170748.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 4565148..4565206 | + | 59 | - | - | Antitoxin |
GR930_RS22090 | 4565467..4565574 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
GR930_RS22095 | 4566050..4567321 | + | 1272 | WP_001545666.1 | amino acid permease | - |
GR930_RS22100 | 4567338..4568345 | - | 1008 | WP_001262467.1 | HipA domain-containing protein | - |
GR930_RS22105 | 4568345..4568656 | - | 312 | WP_001312177.1 | HipA N-terminal domain-containing protein | - |
GR930_RS22110 | 4568641..4568964 | - | 324 | WP_000563102.1 | helix-turn-helix transcriptional regulator | - |
GR930_RS22115 | 4569189..4570202 | - | 1014 | WP_000103572.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3913.76 Da Isoelectric Point: 9.0157
>T35440 WP_000170748.1 NZ_AP022351:c4565091-4564984 [Escherichia coli]
MTLAELGMAFWHDLAVPVITGILASMIVSWLNKRK
MTLAELGMAFWHDLAVPVITGILASMIVSWLNKRK
Download Length: 108 bp
>T35440 NZ_AP022351:c4565091-4564984 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGTTCCGGTCATTACTGGCATTCTTGCCAGTATGAT
CGTGAGCTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGTTCCGGTCATTACTGGCATTCTTGCCAGTATGAT
CGTGAGCTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 59 bp
>AT35440 NZ_AP022351:4565148-4565206 [Escherichia coli]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|