Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 2162929..2163150 Replicon chromosome
Accession NZ_AP022351
Organism Escherichia coli strain E138

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag GR930_RS10550 Protein ID WP_001531632.1
Coordinates 2162929..2163036 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 2163084..2163150 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GR930_RS10525 2158773..2159855 + 1083 WP_000804726.1 peptide chain release factor 1 -
GR930_RS10530 2159855..2160688 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
GR930_RS10535 2160685..2161077 + 393 WP_000200375.1 invasion regulator SirB2 -
GR930_RS10540 2161081..2161890 + 810 WP_001257044.1 invasion regulator SirB1 -
GR930_RS10545 2161926..2162780 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
GR930_RS10550 2162929..2163036 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2163084..2163150 + 67 NuclAT_10 - Antitoxin
- 2163084..2163150 + 67 NuclAT_10 - Antitoxin
- 2163084..2163150 + 67 NuclAT_10 - Antitoxin
- 2163084..2163150 + 67 NuclAT_10 - Antitoxin
- 2163084..2163150 + 67 NuclAT_11 - Antitoxin
- 2163084..2163150 + 67 NuclAT_11 - Antitoxin
- 2163084..2163150 + 67 NuclAT_11 - Antitoxin
- 2163084..2163150 + 67 NuclAT_11 - Antitoxin
- 2163084..2163150 + 67 NuclAT_12 - Antitoxin
- 2163084..2163150 + 67 NuclAT_12 - Antitoxin
- 2163084..2163150 + 67 NuclAT_12 - Antitoxin
- 2163084..2163150 + 67 NuclAT_12 - Antitoxin
- 2163084..2163150 + 67 NuclAT_13 - Antitoxin
- 2163084..2163150 + 67 NuclAT_13 - Antitoxin
- 2163084..2163150 + 67 NuclAT_13 - Antitoxin
- 2163084..2163150 + 67 NuclAT_13 - Antitoxin
- 2163084..2163150 + 67 NuclAT_14 - Antitoxin
- 2163084..2163150 + 67 NuclAT_14 - Antitoxin
- 2163084..2163150 + 67 NuclAT_14 - Antitoxin
- 2163084..2163150 + 67 NuclAT_14 - Antitoxin
- 2163084..2163150 + 67 NuclAT_15 - Antitoxin
- 2163084..2163150 + 67 NuclAT_15 - Antitoxin
- 2163084..2163150 + 67 NuclAT_15 - Antitoxin
- 2163084..2163150 + 67 NuclAT_15 - Antitoxin
- 2163086..2163149 + 64 NuclAT_17 - -
- 2163086..2163149 + 64 NuclAT_17 - -
- 2163086..2163149 + 64 NuclAT_17 - -
- 2163086..2163149 + 64 NuclAT_17 - -
- 2163086..2163149 + 64 NuclAT_18 - -
- 2163086..2163149 + 64 NuclAT_18 - -
- 2163086..2163149 + 64 NuclAT_18 - -
- 2163086..2163149 + 64 NuclAT_18 - -
- 2163086..2163149 + 64 NuclAT_19 - -
- 2163086..2163149 + 64 NuclAT_19 - -
- 2163086..2163149 + 64 NuclAT_19 - -
- 2163086..2163149 + 64 NuclAT_19 - -
- 2163086..2163149 + 64 NuclAT_20 - -
- 2163086..2163149 + 64 NuclAT_20 - -
- 2163086..2163149 + 64 NuclAT_20 - -
- 2163086..2163149 + 64 NuclAT_20 - -
- 2163086..2163149 + 64 NuclAT_21 - -
- 2163086..2163149 + 64 NuclAT_21 - -
- 2163086..2163149 + 64 NuclAT_21 - -
- 2163086..2163149 + 64 NuclAT_21 - -
- 2163086..2163149 + 64 NuclAT_22 - -
- 2163086..2163149 + 64 NuclAT_22 - -
- 2163086..2163149 + 64 NuclAT_22 - -
- 2163086..2163149 + 64 NuclAT_22 - -
- 2163086..2163151 + 66 NuclAT_23 - -
- 2163086..2163151 + 66 NuclAT_23 - -
- 2163086..2163151 + 66 NuclAT_23 - -
- 2163086..2163151 + 66 NuclAT_23 - -
- 2163086..2163151 + 66 NuclAT_24 - -
- 2163086..2163151 + 66 NuclAT_24 - -
- 2163086..2163151 + 66 NuclAT_24 - -
- 2163086..2163151 + 66 NuclAT_24 - -
- 2163086..2163151 + 66 NuclAT_25 - -
- 2163086..2163151 + 66 NuclAT_25 - -
- 2163086..2163151 + 66 NuclAT_25 - -
- 2163086..2163151 + 66 NuclAT_25 - -
- 2163086..2163151 + 66 NuclAT_26 - -
- 2163086..2163151 + 66 NuclAT_26 - -
- 2163086..2163151 + 66 NuclAT_26 - -
- 2163086..2163151 + 66 NuclAT_26 - -
- 2163086..2163151 + 66 NuclAT_27 - -
- 2163086..2163151 + 66 NuclAT_27 - -
- 2163086..2163151 + 66 NuclAT_27 - -
- 2163086..2163151 + 66 NuclAT_27 - -
GR930_RS10555 2163441..2164541 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
GR930_RS10560 2164811..2165050 + 240 WP_000120702.1 putative cation transport regulator ChaB -
GR930_RS10565 2165199..2165894 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
GR930_RS10570 2165938..2166291 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
GR930_RS10575 2166476..2167870 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T35421 WP_001531632.1 NZ_AP022351:c2163036-2162929 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T35421 NZ_AP022351:c2163036-2162929 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACAACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT35421 NZ_AP022351:2163084-2163150 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References