Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sib/- |
Location | 295478..295720 | Replicon | chromosome |
Accession | NZ_AP022351 | ||
Organism | Escherichia coli strain E138 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | GR930_RS01455 | Protein ID | WP_001312861.1 |
Coordinates | 295478..295636 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sib | ||
Locus tag | - | ||
Coordinates | 295680..295720 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GR930_RS01420 | 290590..290817 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
GR930_RS01425 | 290905..291582 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
GR930_RS01430 | 291716..292099 | - | 384 | WP_001151566.1 | relaxosome protein TraM | - |
GR930_RS01435 | 292430..293032 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
GR930_RS01440 | 293329..294150 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
GR930_RS01445 | 294269..294556 | - | 288 | WP_000107535.1 | hypothetical protein | - |
GR930_RS23245 | 294581..294787 | - | 207 | WP_000275859.1 | hypothetical protein | - |
GR930_RS01455 | 295478..295636 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 295680..295720 | - | 41 | NuclAT_1 | - | Antitoxin |
- | 295680..295720 | - | 41 | NuclAT_1 | - | Antitoxin |
- | 295680..295720 | - | 41 | NuclAT_1 | - | Antitoxin |
- | 295680..295720 | - | 41 | NuclAT_1 | - | Antitoxin |
GR930_RS01460 | 295747..297117 | - | 1371 | Protein_273 | IS3-like element IS150 family transposase | - |
- | 297165..297351 | - | 187 | NuclAT_0 | - | - |
- | 297165..297351 | - | 187 | NuclAT_0 | - | - |
- | 297165..297351 | - | 187 | NuclAT_0 | - | - |
- | 297165..297351 | - | 187 | NuclAT_0 | - | - |
GR930_RS01465 | 297363..298082 | - | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
GR930_RS01470 | 298079..298513 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
GR930_RS01475 | 298568..300526 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | tufA | 292523..339364 | 46841 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T35409 WP_001312861.1 NZ_AP022351:c295636-295478 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T35409 NZ_AP022351:c295636-295478 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 41 bp
>AT35409 NZ_AP022351:c295720-295680 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|