Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 66918..67171 | Replicon | plasmid p18044_2 |
| Accession | NZ_AP022328 | ||
| Organism | Escherichia coli O25:H4 strain 18044 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | ECO25NV_RS25760 | Protein ID | WP_001312851.1 |
| Coordinates | 67022..67171 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 66918..66977 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECO25NV_RS25725 | 62694..63554 | + | 861 | WP_000704523.1 | alpha/beta hydrolase | - |
| ECO25NV_RS25730 | 63657..64217 | + | 561 | WP_000139321.1 | fertility inhibition protein FinO | - |
| ECO25NV_RS25735 | 64346..64558 | + | 213 | WP_001309245.1 | ANR family transcriptional regulator | - |
| ECO25NV_RS25740 | 64803..65264 | + | 462 | WP_001233838.1 | thermonuclease family protein | - |
| ECO25NV_RS25745 | 65310..65519 | + | 210 | WP_001298565.1 | hemolysin expression modulator Hha | - |
| ECO25NV_RS25750 | 65557..66147 | + | 591 | WP_033807967.1 | DUF2726 domain-containing protein | - |
| ECO25NV_RS25755 | 66302..66775 | + | 474 | WP_016240489.1 | hypothetical protein | - |
| - | 66918..66977 | - | 60 | NuclAT_1 | - | Antitoxin |
| - | 66918..66977 | - | 60 | NuclAT_1 | - | Antitoxin |
| - | 66918..66977 | - | 60 | NuclAT_1 | - | Antitoxin |
| - | 66918..66977 | - | 60 | NuclAT_1 | - | Antitoxin |
| ECO25NV_RS25760 | 67022..67171 | + | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| ECO25NV_RS25765 | 67456..67704 | + | 249 | WP_000083839.1 | replication regulatory protein RepA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..67915 | 67915 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T35360 WP_001312851.1 NZ_AP022328:67022-67171 [Escherichia coli O25:H4]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T35360 NZ_AP022328:67022-67171 [Escherichia coli O25:H4]
ATGACGAAGTATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAGTATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT35360 NZ_AP022328:c66977-66918 [Escherichia coli O25:H4]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|