Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 22889..23159 | Replicon | plasmid p18044_2 |
| Accession | NZ_AP022328 | ||
| Organism | Escherichia coli O25:H4 strain 18044 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | ECO25NV_RS25500 | Protein ID | WP_001312861.1 |
| Coordinates | 23001..23159 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 22889..22952 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECO25NV_RS25460 | 18176..18511 | + | 336 | WP_077763704.1 | hypothetical protein | - |
| ECO25NV_RS25465 | 18424..18630 | + | 207 | WP_000275853.1 | hypothetical protein | - |
| ECO25NV_RS25470 | 18656..19195 | + | 540 | WP_097498141.1 | single-stranded DNA-binding protein | - |
| ECO25NV_RS25475 | 19258..19492 | + | 235 | Protein_29 | DUF905 family protein | - |
| ECO25NV_RS25480 | 19558..21516 | + | 1959 | WP_000117163.1 | ParB/RepB/Spo0J family partition protein | - |
| ECO25NV_RS25485 | 21571..22005 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| ECO25NV_RS25490 | 22002..22721 | + | 720 | WP_052925806.1 | plasmid SOS inhibition protein A | - |
| ECO25NV_RS25495 | 22733..22921 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 22733..22957 | + | 225 | NuclAT_0 | - | - |
| - | 22733..22957 | + | 225 | NuclAT_0 | - | - |
| - | 22733..22957 | + | 225 | NuclAT_0 | - | - |
| - | 22733..22957 | + | 225 | NuclAT_0 | - | - |
| - | 22889..22952 | - | 64 | - | - | Antitoxin |
| ECO25NV_RS25500 | 23001..23159 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| ECO25NV_RS25505 | 23562..24212 | + | 651 | WP_001487415.1 | IS66 family insertion sequence hypothetical protein | - |
| ECO25NV_RS25510 | 24212..24559 | + | 348 | WP_000624618.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| ECO25NV_RS25515 | 24579..26150 | + | 1572 | WP_199805184.1 | IS66 family transposase | - |
| ECO25NV_RS25520 | 26768..27064 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| ECO25NV_RS25525 | 27175..27996 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..67915 | 67915 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T35356 WP_001312861.1 NZ_AP022328:23001-23159 [Escherichia coli O25:H4]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T35356 NZ_AP022328:23001-23159 [Escherichia coli O25:H4]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT35356 NZ_AP022328:c22952-22889 [Escherichia coli O25:H4]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|