Detailed information of TA system TA035346

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 67043..67282
• Replicon: plasmid p18044_1
• Accession: NZ_AP022327
• Organism: Escherichia coli O25:H4 strain 18044

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: A0A762TWR7
• Locus tag: ECO25NV_RS24905
• Protein ID: WP_023144756.1
• Coordinates: 67043..67177 (-)
• Length: 45 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	67222..67282 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
ECO25NV_RS24870	63054..63455	-	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-
ECO25NV_RS24875	63388..63645	-	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
ECO25NV_RS24880	63738..64391	-	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
ECO25NV_RS24885	65331..66188	-	858	WP_001617855.1	incFII family plasmid replication initiator RepA	-
ECO25NV_RS24890	66181..66255	-	75	WP_031943482.1	RepA leader peptide Tap	-
ECO25NV_RS24895	66252..66386	-	135	Protein_78	protein CopA/IncA	-
ECO25NV_RS24900	66492..66746	-	255	WP_000083850.1	replication regulatory protein RepA	-
ECO25NV_RS24905	67043..67177	-	135	WP_023144756.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	67222..67282	+	61	NuclAT_2	-	Antitoxin
-	67222..67282	+	61	NuclAT_2	-	Antitoxin
-	67222..67282	+	61	NuclAT_2	-	Antitoxin
-	67222..67282	+	61	NuclAT_2	-	Antitoxin
ECO25NV_RS24910	67249..67535	-	287	Protein_81	DUF2726 domain-containing protein	-
ECO25NV_RS24915	67613..69226	-	1614	WP_000080195.1	IS66-like element ISEc23 family transposase	-
ECO25NV_RS24920	69257..69607	-	351	WP_000624722.1	IS66 family insertion sequence element accessory protein TnpB	-
ECO25NV_RS24925	69604..70029	-	426	WP_000422741.1	IS66 family insertion sequence hypothetical protein	-
ECO25NV_RS24930	70588..70800	-	213	WP_013023861.1	hypothetical protein	-
ECO25NV_RS24935	70931..71491	-	561	WP_000139341.1	fertility inhibition protein FinO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	dfrA17 / aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaTEM-1B	senB	1..139450	139450

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-44)

Sequences

Toxin

Protein

• Length: 45 a.a.
• Molecular weight: 4896.90 Da
• Isoelectric Point: 7.7209

>T35346 WP_023144756.1 NZ_AP022327:c67177-67043 [Escherichia coli O25:H4]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Nucleotide

• Length: 135 bp

>T35346 NZ_AP022327:c67177-67043 [Escherichia coli O25:H4]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA

Antitoxin

Nucleotide

• Length: 61 bp

>AT35346 NZ_AP022327:67222-67282 [Escherichia coli O25:H4]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A762TWR7

Antitoxin