Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 11247..11517 | Replicon | plasmid pBEC1-S17-ESBL-09_1 |
Accession | NZ_AP022299 | ||
Organism | Escherichia coli strain BEC1-S17-ESBL-09 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | H7R48_RS24515 | Protein ID | WP_001312861.1 |
Coordinates | 11359..11517 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 11247..11310 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H7R48_RS24490 | 6280..7491 | + | 1212 | WP_001390768.1 | dispersin export-associated protein AatD | - |
H7R48_RS24500 | 9929..10363 | + | 435 | WP_139451276.1 | conjugation system SOS inhibitor PsiB | - |
H7R48_RS24505 | 10360..11079 | + | 720 | WP_001403352.1 | plasmid SOS inhibition protein A | - |
- | 11091..11315 | + | 225 | NuclAT_0 | - | - |
- | 11091..11315 | + | 225 | NuclAT_0 | - | - |
- | 11091..11315 | + | 225 | NuclAT_0 | - | - |
- | 11091..11315 | + | 225 | NuclAT_0 | - | - |
H7R48_RS24510 | 11100..11279 | - | 180 | WP_001309233.1 | hypothetical protein | - |
- | 11247..11310 | - | 64 | - | - | Antitoxin |
H7R48_RS24515 | 11359..11517 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
H7R48_RS24520 | 11820..12069 | - | 250 | Protein_13 | hypothetical protein | - |
H7R48_RS24525 | 12370..12657 | + | 288 | WP_000107526.1 | hypothetical protein | - |
H7R48_RS24530 | 12776..13597 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
H7R48_RS24535 | 13892..14482 | - | 591 | WP_167575169.1 | transglycosylase SLT domain-containing protein | - |
H7R48_RS24540 | 14825..15208 | + | 384 | WP_001151564.1 | relaxosome protein TraM | - |
H7R48_RS24545 | 15402..16088 | + | 687 | WP_139451277.1 | PAS domain-containing protein | - |
H7R48_RS24550 | 16182..16409 | + | 228 | WP_139451278.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | pic / agg3D / agg3C / agg3B / agg3A / aap/aspU | 1..123266 | 123266 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T35281 WP_001312861.1 NZ_AP022299:11359-11517 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T35281 NZ_AP022299:11359-11517 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT35281 NZ_AP022299:c11310-11247 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|