Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 38624..38888 | Replicon | plasmid pWP9-S17-ESBL-11_2 |
| Accession | NZ_AP022289 | ||
| Organism | Escherichia coli strain WP9-S17-ESBL-11 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | H7R47_RS25985 | Protein ID | WP_001331364.1 |
| Coordinates | 38736..38888 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 38624..38686 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7R47_RS25970 | 34666..35736 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
| H7R47_RS25975 | 35755..36963 | - | 1209 | WP_001383960.1 | IncI1-type conjugal transfer protein TrbA | - |
| H7R47_RS25980 | 37181..38167 | - | 987 | WP_001257838.1 | hypothetical protein | - |
| - | 38328..38383 | - | 56 | NuclAT_1 | - | - |
| - | 38328..38383 | - | 56 | NuclAT_1 | - | - |
| - | 38328..38383 | - | 56 | NuclAT_1 | - | - |
| - | 38328..38383 | - | 56 | NuclAT_1 | - | - |
| - | 38624..38686 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 38624..38686 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 38624..38686 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 38624..38686 | - | 63 | NuclAT_0 | - | Antitoxin |
| H7R47_RS25985 | 38736..38888 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| H7R47_RS25990 | 38960..39212 | - | 253 | Protein_48 | hypothetical protein | - |
| H7R47_RS25995 | 39512..39808 | + | 297 | WP_001275298.1 | hypothetical protein | - |
| H7R47_RS26000 | 39873..40049 | - | 177 | WP_001054900.1 | hypothetical protein | - |
| H7R47_RS26005 | 40381..40590 | + | 210 | WP_182927284.1 | HEAT repeat domain-containing protein | - |
| H7R47_RS26010 | 40662..41312 | - | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| H7R47_RS26015 | 41386..43554 | - | 2169 | WP_000698357.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..82448 | 82448 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T35225 WP_001331364.1 NZ_AP022289:38736-38888 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T35225 NZ_AP022289:38736-38888 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT35225 NZ_AP022289:c38686-38624 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|