Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 47913..48177 | Replicon | plasmid pWP8-S18-ESBL-07_2 |
Accession | NZ_AP022263 | ||
Organism | Escherichia coli strain WP8-S18-ESBL-07 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | E6BRV3 |
Locus tag | H7R25_RS24375 | Protein ID | WP_001303307.1 |
Coordinates | 48025..48177 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 47913..47975 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H7R25_RS24360 | 44014..45084 | - | 1071 | WP_000151590.1 | IncI1-type conjugal transfer protein TrbB | - |
H7R25_RS24365 | 45103..46311 | - | 1209 | WP_001295719.1 | IncI1-type conjugal transfer protein TrbA | - |
- | 46491..46549 | - | 59 | NuclAT_1 | - | - |
- | 46491..46549 | - | 59 | NuclAT_1 | - | - |
- | 46491..46549 | - | 59 | NuclAT_1 | - | - |
- | 46491..46549 | - | 59 | NuclAT_1 | - | - |
H7R25_RS24370 | 46619..47710 | - | 1092 | WP_001756226.1 | hypothetical protein | - |
- | 47913..47975 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 47913..47975 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 47913..47975 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 47913..47975 | - | 63 | NuclAT_0 | - | Antitoxin |
H7R25_RS24375 | 48025..48177 | + | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
H7R25_RS24380 | 48249..48500 | - | 252 | WP_001291965.1 | hypothetical protein | - |
H7R25_RS24385 | 48800..49096 | + | 297 | WP_001275298.1 | hypothetical protein | - |
H7R25_RS24390 | 49161..49337 | - | 177 | WP_001054898.1 | hypothetical protein | - |
H7R25_RS24395 | 49739..49948 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
H7R25_RS24400 | 50020..50682 | - | 663 | WP_000644795.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
H7R25_RS24405 | 50753..52921 | - | 2169 | WP_000698356.1 | DotA/TraY family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | qnrS1 / blaCTX-M-15 | - | 1..91233 | 91233 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T35137 WP_001303307.1 NZ_AP022263:48025-48177 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T35137 NZ_AP022263:48025-48177 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT35137 NZ_AP022263:c47975-47913 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|