Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 67352..67592 | Replicon | plasmid pWP8-S17-ESBL-12_1 |
| Accession | NZ_AP022223 | ||
| Organism | Escherichia coli strain WP8-S17-ESBL-12 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | H7R20_RS24105 | Protein ID | WP_001312861.1 |
| Coordinates | 67434..67592 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 67352..67390 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7R20_RS24060 | 62584..62796 | + | 213 | WP_001348622.1 | hypothetical protein | - |
| H7R20_RS24065 | 63206..63412 | + | 207 | WP_000275856.1 | hypothetical protein | - |
| H7R20_RS24070 | 63438..63977 | + | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
| H7R20_RS24075 | 64045..64278 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
| H7R20_RS24080 | 64306..64503 | + | 198 | Protein_79 | hypothetical protein | - |
| H7R20_RS24085 | 64558..64992 | + | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
| H7R20_RS24090 | 64989..65708 | + | 720 | WP_001276238.1 | plasmid SOS inhibition protein A | - |
| H7R20_RS24095 | 65720..65908 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 65720..65910 | + | 191 | NuclAT_0 | - | - |
| - | 65720..65910 | + | 191 | NuclAT_0 | - | - |
| - | 65720..65910 | + | 191 | NuclAT_0 | - | - |
| - | 65720..65910 | + | 191 | NuclAT_0 | - | - |
| H7R20_RS24100 | 65958..67327 | + | 1370 | WP_085947770.1 | IS3-like element IS150 family transposase | - |
| - | 67352..67390 | + | 39 | NuclAT_1 | - | Antitoxin |
| - | 67352..67390 | + | 39 | NuclAT_1 | - | Antitoxin |
| - | 67352..67390 | + | 39 | NuclAT_1 | - | Antitoxin |
| - | 67352..67390 | + | 39 | NuclAT_1 | - | Antitoxin |
| H7R20_RS24105 | 67434..67592 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| H7R20_RS24110 | 68513..68800 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| H7R20_RS24115 | 68918..69739 | + | 822 | WP_001234426.1 | DUF945 domain-containing protein | - |
| H7R20_RS24120 | 70036..70638 | - | 603 | WP_013362798.1 | transglycosylase SLT domain-containing protein | - |
| H7R20_RS24125 | 70959..71342 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
| H7R20_RS24130 | 71529..72218 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(B) / catA1 / blaTEM-1B | - | 1..139020 | 139020 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T35041 WP_001312861.1 NZ_AP022223:67434-67592 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T35041 NZ_AP022223:67434-67592 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 39 bp
>AT35041 NZ_AP022223:67352-67390 [Escherichia coli]
CATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
CATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|