Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 110133..110403 | Replicon | plasmid pWP7-S18-ESBL-09_1 |
Accession | NZ_AP022208 | ||
Organism | Escherichia coli strain WP7-S18-ESBL-09 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | H7R37_RS25675 | Protein ID | WP_001312861.1 |
Coordinates | 110245..110403 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 110133..110196 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H7R37_RS25640 | 105146..105601 | - | 456 | WP_059337654.1 | hypothetical protein | - |
H7R37_RS25645 | 105903..106430 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
H7R37_RS25650 | 106488..106721 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
H7R37_RS25655 | 106782..108746 | + | 1965 | WP_025746229.1 | ParB/RepB/Spo0J family partition protein | - |
H7R37_RS25660 | 108815..109249 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
H7R37_RS25665 | 109246..109965 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 109977..110201 | + | 225 | NuclAT_0 | - | - |
- | 109977..110201 | + | 225 | NuclAT_0 | - | - |
- | 109977..110201 | + | 225 | NuclAT_0 | - | - |
- | 109977..110201 | + | 225 | NuclAT_0 | - | - |
H7R37_RS25670 | 109986..110165 | - | 180 | WP_001309233.1 | hypothetical protein | - |
- | 110133..110196 | - | 64 | - | - | Antitoxin |
H7R37_RS25675 | 110245..110403 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
H7R37_RS25680 | 110704..110908 | - | 205 | Protein_144 | pilus protein | - |
H7R37_RS25685 | 111300..111596 | + | 297 | WP_001272251.1 | hypothetical protein | - |
H7R37_RS25690 | 111707..112528 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
H7R37_RS25695 | 112825..113415 | - | 591 | WP_000252683.1 | transglycosylase SLT domain-containing protein | - |
H7R37_RS25700 | 113748..114131 | + | 384 | WP_001151529.1 | relaxosome protein TraM | - |
H7R37_RS25705 | 114324..114971 | + | 648 | WP_000332523.1 | transcriptional regulator TraJ family protein | - |
H7R37_RS25710 | 115079..115318 | + | 240 | WP_042018283.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B / aac(3)-IId / dfrA17 / aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) | senB | 1..214586 | 214586 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T34943 WP_001312861.1 NZ_AP022208:110245-110403 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T34943 NZ_AP022208:110245-110403 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT34943 NZ_AP022208:c110196-110133 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|