Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 83660..83913 | Replicon | plasmid pWP7-S18-ESBL-09_1 |
| Accession | NZ_AP022208 | ||
| Organism | Escherichia coli strain WP7-S18-ESBL-09 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | H7R37_RS25490 | Protein ID | WP_001312851.1 |
| Coordinates | 83764..83913 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 83660..83719 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7R37_RS25455 | 78838..79299 | + | 462 | WP_001233838.1 | thermonuclease family protein | - |
| H7R37_RS25460 | 79345..79554 | + | 210 | WP_001298565.1 | hemolysin expression modulator Hha | - |
| H7R37_RS25465 | 79592..80182 | + | 591 | WP_033807967.1 | DUF2726 domain-containing protein | - |
| H7R37_RS25470 | 80369..81940 | - | 1572 | WP_001526014.1 | IS66 family transposase | - |
| H7R37_RS25475 | 81960..82307 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| H7R37_RS25480 | 82307..82984 | - | 678 | WP_001339397.1 | IS66 family insertion sequence hypothetical protein | - |
| H7R37_RS25485 | 83044..83517 | + | 474 | WP_016240489.1 | hypothetical protein | - |
| - | 83660..83719 | - | 60 | NuclAT_2 | - | Antitoxin |
| - | 83660..83719 | - | 60 | NuclAT_2 | - | Antitoxin |
| - | 83660..83719 | - | 60 | NuclAT_2 | - | Antitoxin |
| - | 83660..83719 | - | 60 | NuclAT_2 | - | Antitoxin |
| H7R37_RS25490 | 83764..83913 | + | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| H7R37_RS25495 | 84198..84446 | + | 249 | WP_000083839.1 | replication regulatory protein RepA | - |
| H7R37_RS25500 | 84691..84765 | + | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| H7R37_RS25505 | 84758..85615 | + | 858 | WP_016240488.1 | incFII family plasmid replication initiator RepA | - |
| H7R37_RS25510 | 86686..86949 | + | 264 | WP_001089473.1 | hypothetical protein | - |
| H7R37_RS25515 | 86939..87238 | + | 300 | WP_182916814.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| H7R37_RS25520 | 87274..87939 | - | 666 | WP_001535733.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / aac(3)-IId / dfrA17 / aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) | senB | 1..214586 | 214586 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T34940 WP_001312851.1 NZ_AP022208:83764-83913 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T34940 NZ_AP022208:83764-83913 [Escherichia coli]
ATGACGAAGTATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAGTATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT34940 NZ_AP022208:c83719-83660 [Escherichia coli]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|