Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 117297..117566 | Replicon | plasmid pWP5-S18-ESBL-08_1 |
| Accession | NZ_AP022162 | ||
| Organism | Escherichia coli strain WP5-S18-ESBL-08 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | H7R36_RS25550 | Protein ID | WP_001312861.1 |
| Coordinates | 117408..117566 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 117297..117362 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7R36_RS25530 | 112518..114476 | + | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
| H7R36_RS25535 | 114531..114965 | + | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| H7R36_RS25540 | 114962..115681 | + | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
| - | 115693..115795 | + | 103 | NuclAT_1 | - | - |
| - | 115693..115795 | + | 103 | NuclAT_1 | - | - |
| - | 115693..115795 | + | 103 | NuclAT_1 | - | - |
| - | 115693..115795 | + | 103 | NuclAT_1 | - | - |
| H7R36_RS25545 | 115841..117210 | + | 1370 | WP_085947770.1 | IS3-like element IS150 family transposase | - |
| - | 117237..117364 | + | 128 | NuclAT_0 | - | - |
| - | 117237..117364 | + | 128 | NuclAT_0 | - | - |
| - | 117237..117364 | + | 128 | NuclAT_0 | - | - |
| - | 117237..117364 | + | 128 | NuclAT_0 | - | - |
| - | 117297..117362 | + | 66 | - | - | Antitoxin |
| H7R36_RS25550 | 117408..117566 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| H7R36_RS25555 | 117861..118016 | + | 156 | WP_001380190.1 | hypothetical protein | - |
| H7R36_RS25560 | 118341..119096 | - | 756 | WP_001282653.1 | IS21-like element ISSso4 family helper ATPase IstB | - |
| H7R36_RS25565 | 119113..120648 | - | 1536 | WP_000447015.1 | IS21 family transposase | - |
| H7R36_RS25570 | 120902..121108 | + | 207 | WP_000275859.1 | hypothetical protein | - |
| H7R36_RS25575 | 121133..121420 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| H7R36_RS25580 | 121539..122360 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / blaCTX-M-15 / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / tet(B) / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..147186 | 147186 | |
| - | inside | IScluster/Tn | - | - | 115841..120648 | 4807 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T34781 WP_001312861.1 NZ_AP022162:117408-117566 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T34781 NZ_AP022162:117408-117566 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT34781 NZ_AP022162:117297-117362 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|