Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 59830..60094 | Replicon | plasmid pWP5-W18-ESBL-11_2 |
| Accession | NZ_AP022122 | ||
| Organism | Escherichia coli strain WP5-W18-ESBL-11 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | H7R04_RS23885 | Protein ID | WP_001303307.1 |
| Coordinates | 59942..60094 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 59830..59892 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7R04_RS23870 | 55069..57360 | - | 2292 | WP_024255997.1 | hypothetical protein | - |
| H7R04_RS23875 | 57353..58423 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
| H7R04_RS23880 | 58442..59650 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - | 59830..59892 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 59830..59892 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 59830..59892 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 59830..59892 | - | 63 | NuclAT_0 | - | Antitoxin |
| H7R04_RS23885 | 59942..60094 | + | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| H7R04_RS23890 | 60166..60417 | - | 252 | WP_001291965.1 | hypothetical protein | - |
| - | 60804..60855 | - | 52 | NuclAT_1 | - | - |
| - | 60804..60855 | - | 52 | NuclAT_1 | - | - |
| - | 60804..60855 | - | 52 | NuclAT_1 | - | - |
| - | 60804..60855 | - | 52 | NuclAT_1 | - | - |
| H7R04_RS23895 | 61341..61517 | - | 177 | WP_001054900.1 | hypothetical protein | - |
| H7R04_RS23900 | 61909..62118 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| H7R04_RS23905 | 62190..62852 | - | 663 | WP_000644794.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| H7R04_RS23910 | 62923..65091 | - | 2169 | WP_052974685.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-8 | - | 1..89476 | 89476 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T34651 WP_001303307.1 NZ_AP022122:59942-60094 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T34651 NZ_AP022122:59942-60094 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT34651 NZ_AP022122:c59892-59830 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|