Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 53733..54154 | Replicon | plasmid pWP5-W18-ESBL-11_1 |
Accession | NZ_AP022121 | ||
Organism | Escherichia coli strain WP5-W18-ESBL-11 |
Toxin (Protein)
Gene name | hok | Uniprot ID | B1VC78 |
Locus tag | H7R04_RS23020 | Protein ID | WP_001302184.1 |
Coordinates | 53996..54154 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 53733..53931 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H7R04_RS22990 | 48836..49345 | - | 510 | WP_071600123.1 | hypothetical protein | - |
H7R04_RS22995 | 49663..50202 | + | 540 | WP_000290801.1 | single-stranded DNA-binding protein | - |
H7R04_RS23000 | 50259..50492 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
H7R04_RS23005 | 50558..52516 | + | 1959 | WP_029487628.1 | ParB/RepB/Spo0J family partition protein | - |
H7R04_RS23010 | 52571..53005 | + | 435 | WP_000845928.1 | conjugation system SOS inhibitor PsiB | - |
H7R04_RS23015 | 53002..53721 | + | 720 | WP_000116348.1 | plasmid SOS inhibition protein A | - |
- | 53733..53931 | + | 199 | NuclAT_0 | - | Antitoxin |
- | 53733..53931 | + | 199 | NuclAT_0 | - | Antitoxin |
- | 53733..53931 | + | 199 | NuclAT_0 | - | Antitoxin |
- | 53733..53931 | + | 199 | NuclAT_0 | - | Antitoxin |
H7R04_RS23020 | 53996..54154 | + | 159 | WP_001302184.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
H7R04_RS23025 | 54392..54751 | - | 360 | Protein_56 | hypothetical protein | - |
H7R04_RS23030 | 54821..55027 | + | 207 | WP_000547965.1 | hypothetical protein | - |
H7R04_RS23035 | 55052..55339 | + | 288 | WP_000107546.1 | hypothetical protein | - |
H7R04_RS23040 | 55458..56279 | + | 822 | WP_001234475.1 | DUF945 domain-containing protein | - |
H7R04_RS23045 | 56574..57164 | - | 591 | WP_166494936.1 | transglycosylase SLT domain-containing protein | - |
H7R04_RS23050 | 57516..57899 | + | 384 | WP_001063020.1 | relaxosome protein TraM | - |
H7R04_RS23055 | 58091..58738 | + | 648 | WP_000332520.1 | conjugal transfer transcriptional regulator TraJ | - |
H7R04_RS23060 | 58874..59089 | + | 216 | WP_001352842.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD / blaTEM-1B | iucA / iucB / iucC / iucD / iutA / vat / iroN / iroE / iroD / iroC / iroB | 1..158291 | 158291 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6108.35 Da Isoelectric Point: 9.1977
>T34644 WP_001302184.1 NZ_AP022121:53996-54154 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
Download Length: 159 bp
>T34644 NZ_AP022121:53996-54154 [Escherichia coli]
ATGAAACTACCACGCAGCTCTCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGATACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGCAGCTCTCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGATACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 199 bp
>AT34644 NZ_AP022121:53733-53931 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|