Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2648196..2648416 Replicon chromosome
Accession NZ_AP022120
Organism Escherichia coli strain WP5-W18-ESBL-11

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag H7R04_RS12600 Protein ID WP_000170965.1
Coordinates 2648309..2648416 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2648196..2648262 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H7R04_RS12575 2643475..2644869 - 1395 WP_000086201.1 inverse autotransporter invasin YchO -
H7R04_RS12580 2645054..2645407 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
H7R04_RS12585 2645451..2646146 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
H7R04_RS12590 2646304..2646534 - 231 WP_001146442.1 putative cation transport regulator ChaB -
H7R04_RS12595 2646804..2647904 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2648196..2648262 - 67 - - Antitoxin
H7R04_RS12600 2648309..2648416 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2648729..2648792 - 64 NuclAT_33 - -
- 2648729..2648792 - 64 NuclAT_33 - -
- 2648729..2648792 - 64 NuclAT_33 - -
- 2648729..2648792 - 64 NuclAT_33 - -
- 2648729..2648792 - 64 NuclAT_36 - -
- 2648729..2648792 - 64 NuclAT_36 - -
- 2648729..2648792 - 64 NuclAT_36 - -
- 2648729..2648792 - 64 NuclAT_36 - -
- 2648729..2648792 - 64 NuclAT_39 - -
- 2648729..2648792 - 64 NuclAT_39 - -
- 2648729..2648792 - 64 NuclAT_39 - -
- 2648729..2648792 - 64 NuclAT_39 - -
- 2648729..2648792 - 64 NuclAT_42 - -
- 2648729..2648792 - 64 NuclAT_42 - -
- 2648729..2648792 - 64 NuclAT_42 - -
- 2648729..2648792 - 64 NuclAT_42 - -
- 2648729..2648792 - 64 NuclAT_45 - -
- 2648729..2648792 - 64 NuclAT_45 - -
- 2648729..2648792 - 64 NuclAT_45 - -
- 2648729..2648792 - 64 NuclAT_45 - -
- 2648729..2648792 - 64 NuclAT_48 - -
- 2648729..2648792 - 64 NuclAT_48 - -
- 2648729..2648792 - 64 NuclAT_48 - -
- 2648729..2648792 - 64 NuclAT_48 - -
- 2648730..2648792 - 63 NuclAT_50 - -
- 2648730..2648792 - 63 NuclAT_50 - -
- 2648730..2648792 - 63 NuclAT_50 - -
- 2648730..2648792 - 63 NuclAT_50 - -
- 2648730..2648792 - 63 NuclAT_53 - -
- 2648730..2648792 - 63 NuclAT_53 - -
- 2648730..2648792 - 63 NuclAT_53 - -
- 2648730..2648792 - 63 NuclAT_53 - -
- 2648730..2648792 - 63 NuclAT_56 - -
- 2648730..2648792 - 63 NuclAT_56 - -
- 2648730..2648792 - 63 NuclAT_56 - -
- 2648730..2648792 - 63 NuclAT_56 - -
- 2648731..2648792 - 62 NuclAT_15 - -
- 2648731..2648792 - 62 NuclAT_15 - -
- 2648731..2648792 - 62 NuclAT_15 - -
- 2648731..2648792 - 62 NuclAT_15 - -
- 2648731..2648792 - 62 NuclAT_18 - -
- 2648731..2648792 - 62 NuclAT_18 - -
- 2648731..2648792 - 62 NuclAT_18 - -
- 2648731..2648792 - 62 NuclAT_18 - -
- 2648731..2648792 - 62 NuclAT_21 - -
- 2648731..2648792 - 62 NuclAT_21 - -
- 2648731..2648792 - 62 NuclAT_21 - -
- 2648731..2648792 - 62 NuclAT_21 - -
- 2648731..2648792 - 62 NuclAT_24 - -
- 2648731..2648792 - 62 NuclAT_24 - -
- 2648731..2648792 - 62 NuclAT_24 - -
- 2648731..2648792 - 62 NuclAT_24 - -
- 2648731..2648792 - 62 NuclAT_27 - -
- 2648731..2648792 - 62 NuclAT_27 - -
- 2648731..2648792 - 62 NuclAT_27 - -
- 2648731..2648792 - 62 NuclAT_27 - -
- 2648731..2648792 - 62 NuclAT_30 - -
- 2648731..2648792 - 62 NuclAT_30 - -
- 2648731..2648792 - 62 NuclAT_30 - -
- 2648731..2648792 - 62 NuclAT_30 - -
H7R04_RS12605 2648845..2648952 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2649265..2649330 - 66 NuclAT_32 - -
- 2649265..2649330 - 66 NuclAT_32 - -
- 2649265..2649330 - 66 NuclAT_32 - -
- 2649265..2649330 - 66 NuclAT_32 - -
- 2649265..2649330 - 66 NuclAT_35 - -
- 2649265..2649330 - 66 NuclAT_35 - -
- 2649265..2649330 - 66 NuclAT_35 - -
- 2649265..2649330 - 66 NuclAT_35 - -
- 2649265..2649330 - 66 NuclAT_38 - -
- 2649265..2649330 - 66 NuclAT_38 - -
- 2649265..2649330 - 66 NuclAT_38 - -
- 2649265..2649330 - 66 NuclAT_38 - -
- 2649265..2649330 - 66 NuclAT_41 - -
- 2649265..2649330 - 66 NuclAT_41 - -
- 2649265..2649330 - 66 NuclAT_41 - -
- 2649265..2649330 - 66 NuclAT_41 - -
- 2649265..2649330 - 66 NuclAT_44 - -
- 2649265..2649330 - 66 NuclAT_44 - -
- 2649265..2649330 - 66 NuclAT_44 - -
- 2649265..2649330 - 66 NuclAT_44 - -
- 2649265..2649330 - 66 NuclAT_47 - -
- 2649265..2649330 - 66 NuclAT_47 - -
- 2649265..2649330 - 66 NuclAT_47 - -
- 2649265..2649330 - 66 NuclAT_47 - -
- 2649266..2649332 - 67 NuclAT_49 - -
- 2649266..2649332 - 67 NuclAT_49 - -
- 2649266..2649332 - 67 NuclAT_49 - -
- 2649266..2649332 - 67 NuclAT_49 - -
- 2649266..2649332 - 67 NuclAT_52 - -
- 2649266..2649332 - 67 NuclAT_52 - -
- 2649266..2649332 - 67 NuclAT_52 - -
- 2649266..2649332 - 67 NuclAT_52 - -
- 2649266..2649332 - 67 NuclAT_55 - -
- 2649266..2649332 - 67 NuclAT_55 - -
- 2649266..2649332 - 67 NuclAT_55 - -
- 2649266..2649332 - 67 NuclAT_55 - -
- 2649267..2649330 - 64 NuclAT_14 - -
- 2649267..2649330 - 64 NuclAT_14 - -
- 2649267..2649330 - 64 NuclAT_14 - -
- 2649267..2649330 - 64 NuclAT_14 - -
- 2649267..2649330 - 64 NuclAT_17 - -
- 2649267..2649330 - 64 NuclAT_17 - -
- 2649267..2649330 - 64 NuclAT_17 - -
- 2649267..2649330 - 64 NuclAT_17 - -
- 2649267..2649330 - 64 NuclAT_20 - -
- 2649267..2649330 - 64 NuclAT_20 - -
- 2649267..2649330 - 64 NuclAT_20 - -
- 2649267..2649330 - 64 NuclAT_20 - -
- 2649267..2649330 - 64 NuclAT_23 - -
- 2649267..2649330 - 64 NuclAT_23 - -
- 2649267..2649330 - 64 NuclAT_23 - -
- 2649267..2649330 - 64 NuclAT_23 - -
- 2649267..2649330 - 64 NuclAT_26 - -
- 2649267..2649330 - 64 NuclAT_26 - -
- 2649267..2649330 - 64 NuclAT_26 - -
- 2649267..2649330 - 64 NuclAT_26 - -
- 2649267..2649330 - 64 NuclAT_29 - -
- 2649267..2649330 - 64 NuclAT_29 - -
- 2649267..2649330 - 64 NuclAT_29 - -
- 2649267..2649330 - 64 NuclAT_29 - -
H7R04_RS12610 2649380..2649487 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
H7R04_RS12615 2649636..2650490 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
H7R04_RS12620 2650526..2651335 - 810 WP_001257044.1 invasion regulator SirB1 -
H7R04_RS12625 2651339..2651731 - 393 WP_000200392.1 invasion regulator SirB2 -
H7R04_RS12630 2651728..2652561 - 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T34633 WP_000170965.1 NZ_AP022120:2648309-2648416 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T34633 NZ_AP022120:2648309-2648416 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT34633 NZ_AP022120:c2648262-2648196 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References