Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2674310..2674530 Replicon chromosome
Accession NZ_AP022107
Organism Escherichia coli strain WP5-S17-ESBL-11

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag H7K47_RS12785 Protein ID WP_000170965.1
Coordinates 2674423..2674530 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2674310..2674376 (-)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H7K47_RS12760 2669589..2670983 - 1395 WP_000086201.1 inverse autotransporter invasin YchO -
H7K47_RS12765 2671168..2671521 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
H7K47_RS12770 2671565..2672260 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
H7K47_RS12775 2672418..2672648 - 231 WP_001146442.1 putative cation transport regulator ChaB -
H7K47_RS12780 2672918..2674018 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2674310..2674376 - 67 - - Antitoxin
H7K47_RS12785 2674423..2674530 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2674843..2674906 - 64 NuclAT_33 - -
- 2674843..2674906 - 64 NuclAT_33 - -
- 2674843..2674906 - 64 NuclAT_33 - -
- 2674843..2674906 - 64 NuclAT_33 - -
- 2674843..2674906 - 64 NuclAT_36 - -
- 2674843..2674906 - 64 NuclAT_36 - -
- 2674843..2674906 - 64 NuclAT_36 - -
- 2674843..2674906 - 64 NuclAT_36 - -
- 2674843..2674906 - 64 NuclAT_39 - -
- 2674843..2674906 - 64 NuclAT_39 - -
- 2674843..2674906 - 64 NuclAT_39 - -
- 2674843..2674906 - 64 NuclAT_39 - -
- 2674843..2674906 - 64 NuclAT_42 - -
- 2674843..2674906 - 64 NuclAT_42 - -
- 2674843..2674906 - 64 NuclAT_42 - -
- 2674843..2674906 - 64 NuclAT_42 - -
- 2674843..2674906 - 64 NuclAT_45 - -
- 2674843..2674906 - 64 NuclAT_45 - -
- 2674843..2674906 - 64 NuclAT_45 - -
- 2674843..2674906 - 64 NuclAT_45 - -
- 2674843..2674906 - 64 NuclAT_48 - -
- 2674843..2674906 - 64 NuclAT_48 - -
- 2674843..2674906 - 64 NuclAT_48 - -
- 2674843..2674906 - 64 NuclAT_48 - -
- 2674844..2674906 - 63 NuclAT_50 - -
- 2674844..2674906 - 63 NuclAT_50 - -
- 2674844..2674906 - 63 NuclAT_50 - -
- 2674844..2674906 - 63 NuclAT_50 - -
- 2674844..2674906 - 63 NuclAT_53 - -
- 2674844..2674906 - 63 NuclAT_53 - -
- 2674844..2674906 - 63 NuclAT_53 - -
- 2674844..2674906 - 63 NuclAT_53 - -
- 2674844..2674906 - 63 NuclAT_56 - -
- 2674844..2674906 - 63 NuclAT_56 - -
- 2674844..2674906 - 63 NuclAT_56 - -
- 2674844..2674906 - 63 NuclAT_56 - -
- 2674845..2674906 - 62 NuclAT_15 - -
- 2674845..2674906 - 62 NuclAT_15 - -
- 2674845..2674906 - 62 NuclAT_15 - -
- 2674845..2674906 - 62 NuclAT_15 - -
- 2674845..2674906 - 62 NuclAT_18 - -
- 2674845..2674906 - 62 NuclAT_18 - -
- 2674845..2674906 - 62 NuclAT_18 - -
- 2674845..2674906 - 62 NuclAT_18 - -
- 2674845..2674906 - 62 NuclAT_21 - -
- 2674845..2674906 - 62 NuclAT_21 - -
- 2674845..2674906 - 62 NuclAT_21 - -
- 2674845..2674906 - 62 NuclAT_21 - -
- 2674845..2674906 - 62 NuclAT_24 - -
- 2674845..2674906 - 62 NuclAT_24 - -
- 2674845..2674906 - 62 NuclAT_24 - -
- 2674845..2674906 - 62 NuclAT_24 - -
- 2674845..2674906 - 62 NuclAT_27 - -
- 2674845..2674906 - 62 NuclAT_27 - -
- 2674845..2674906 - 62 NuclAT_27 - -
- 2674845..2674906 - 62 NuclAT_27 - -
- 2674845..2674906 - 62 NuclAT_30 - -
- 2674845..2674906 - 62 NuclAT_30 - -
- 2674845..2674906 - 62 NuclAT_30 - -
- 2674845..2674906 - 62 NuclAT_30 - -
H7K47_RS12790 2674959..2675066 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2675379..2675444 - 66 NuclAT_32 - -
- 2675379..2675444 - 66 NuclAT_32 - -
- 2675379..2675444 - 66 NuclAT_32 - -
- 2675379..2675444 - 66 NuclAT_32 - -
- 2675379..2675444 - 66 NuclAT_35 - -
- 2675379..2675444 - 66 NuclAT_35 - -
- 2675379..2675444 - 66 NuclAT_35 - -
- 2675379..2675444 - 66 NuclAT_35 - -
- 2675379..2675444 - 66 NuclAT_38 - -
- 2675379..2675444 - 66 NuclAT_38 - -
- 2675379..2675444 - 66 NuclAT_38 - -
- 2675379..2675444 - 66 NuclAT_38 - -
- 2675379..2675444 - 66 NuclAT_41 - -
- 2675379..2675444 - 66 NuclAT_41 - -
- 2675379..2675444 - 66 NuclAT_41 - -
- 2675379..2675444 - 66 NuclAT_41 - -
- 2675379..2675444 - 66 NuclAT_44 - -
- 2675379..2675444 - 66 NuclAT_44 - -
- 2675379..2675444 - 66 NuclAT_44 - -
- 2675379..2675444 - 66 NuclAT_44 - -
- 2675379..2675444 - 66 NuclAT_47 - -
- 2675379..2675444 - 66 NuclAT_47 - -
- 2675379..2675444 - 66 NuclAT_47 - -
- 2675379..2675444 - 66 NuclAT_47 - -
- 2675380..2675446 - 67 NuclAT_49 - -
- 2675380..2675446 - 67 NuclAT_49 - -
- 2675380..2675446 - 67 NuclAT_49 - -
- 2675380..2675446 - 67 NuclAT_49 - -
- 2675380..2675446 - 67 NuclAT_52 - -
- 2675380..2675446 - 67 NuclAT_52 - -
- 2675380..2675446 - 67 NuclAT_52 - -
- 2675380..2675446 - 67 NuclAT_52 - -
- 2675380..2675446 - 67 NuclAT_55 - -
- 2675380..2675446 - 67 NuclAT_55 - -
- 2675380..2675446 - 67 NuclAT_55 - -
- 2675380..2675446 - 67 NuclAT_55 - -
- 2675381..2675444 - 64 NuclAT_14 - -
- 2675381..2675444 - 64 NuclAT_14 - -
- 2675381..2675444 - 64 NuclAT_14 - -
- 2675381..2675444 - 64 NuclAT_14 - -
- 2675381..2675444 - 64 NuclAT_17 - -
- 2675381..2675444 - 64 NuclAT_17 - -
- 2675381..2675444 - 64 NuclAT_17 - -
- 2675381..2675444 - 64 NuclAT_17 - -
- 2675381..2675444 - 64 NuclAT_20 - -
- 2675381..2675444 - 64 NuclAT_20 - -
- 2675381..2675444 - 64 NuclAT_20 - -
- 2675381..2675444 - 64 NuclAT_20 - -
- 2675381..2675444 - 64 NuclAT_23 - -
- 2675381..2675444 - 64 NuclAT_23 - -
- 2675381..2675444 - 64 NuclAT_23 - -
- 2675381..2675444 - 64 NuclAT_23 - -
- 2675381..2675444 - 64 NuclAT_26 - -
- 2675381..2675444 - 64 NuclAT_26 - -
- 2675381..2675444 - 64 NuclAT_26 - -
- 2675381..2675444 - 64 NuclAT_26 - -
- 2675381..2675444 - 64 NuclAT_29 - -
- 2675381..2675444 - 64 NuclAT_29 - -
- 2675381..2675444 - 64 NuclAT_29 - -
- 2675381..2675444 - 64 NuclAT_29 - -
H7K47_RS12795 2675494..2675601 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
H7K47_RS12800 2675750..2676604 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
H7K47_RS12805 2676640..2677449 - 810 WP_001257044.1 invasion regulator SirB1 -
H7K47_RS12810 2677453..2677845 - 393 WP_000200392.1 invasion regulator SirB2 -
H7K47_RS12815 2677842..2678675 - 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T34566 WP_000170965.1 NZ_AP022107:2674423-2674530 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T34566 NZ_AP022107:2674423-2674530 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT34566 NZ_AP022107:c2674376-2674310 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029


Antitoxin

Download structure file

References