Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 75824..76088 | Replicon | plasmid pWP4-S18-ESBL-07_1 |
| Accession | NZ_AP022088 | ||
| Organism | Escherichia coli strain WP4-S18-ESBL-07 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | H7R53_RS23880 | Protein ID | WP_001331364.1 |
| Coordinates | 75824..75976 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 76026..76088 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7R53_RS23855 | 71009..73177 | + | 2169 | WP_182920555.1 | DotA/TraY family protein | - |
| H7R53_RS23860 | 73242..73904 | + | 663 | WP_001542510.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| H7R53_RS23865 | 74002..74211 | + | 210 | WP_001140544.1 | hemolysin expression modulator Hha | - |
| H7R53_RS23870 | 74420..74596 | + | 177 | WP_001054905.1 | hypothetical protein | - |
| H7R53_RS23875 | 75501..75752 | + | 252 | WP_001618083.1 | hypothetical protein | - |
| H7R53_RS23880 | 75824..75976 | - | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| - | 76026..76088 | + | 63 | NuclAT_1 | - | Antitoxin |
| - | 76026..76088 | + | 63 | NuclAT_1 | - | Antitoxin |
| - | 76026..76088 | + | 63 | NuclAT_1 | - | Antitoxin |
| - | 76026..76088 | + | 63 | NuclAT_1 | - | Antitoxin |
| H7R53_RS23885 | 76268..77476 | + | 1209 | WP_182920556.1 | IncI1-type conjugal transfer protein TrbA | - |
| H7R53_RS23890 | 77495..78565 | + | 1071 | WP_000151586.1 | IncI1-type conjugal transfer protein TrbB | - |
| H7R53_RS23895 | 78558..80849 | + | 2292 | WP_085326102.1 | conjugal transfer protein TrbC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..183772 | 183772 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T34448 WP_001331364.1 NZ_AP022088:c75976-75824 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T34448 NZ_AP022088:c75976-75824 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT34448 NZ_AP022088:76026-76088 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|