Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 52602..52855 | Replicon | plasmid pWP4-W18-ESBL-09_3 |
| Accession | NZ_AP022072 | ||
| Organism | Escherichia coli strain WP4-W18-ESBL-09 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | H7R28_RS26705 | Protein ID | WP_001312851.1 |
| Coordinates | 52706..52855 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 52602..52661 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7R28_RS26670 | 48378..49238 | + | 861 | WP_000704524.1 | alpha/beta hydrolase | - |
| H7R28_RS26675 | 49341..49901 | + | 561 | WP_000139321.1 | fertility inhibition protein FinO | - |
| H7R28_RS26680 | 50030..50242 | + | 213 | WP_001309245.1 | ANR family transcriptional regulator | - |
| H7R28_RS26685 | 50487..50948 | + | 462 | WP_016230918.1 | thermonuclease family protein | - |
| H7R28_RS26690 | 50994..51203 | + | 210 | WP_001369435.1 | hemolysin expression modulator Hha | - |
| H7R28_RS26695 | 51241..51831 | + | 591 | WP_042018152.1 | DUF2726 domain-containing protein | - |
| H7R28_RS26700 | 51986..52459 | + | 474 | WP_016240489.1 | hypothetical protein | - |
| - | 52602..52661 | - | 60 | NuclAT_1 | - | Antitoxin |
| - | 52602..52661 | - | 60 | NuclAT_1 | - | Antitoxin |
| - | 52602..52661 | - | 60 | NuclAT_1 | - | Antitoxin |
| - | 52602..52661 | - | 60 | NuclAT_1 | - | Antitoxin |
| H7R28_RS26705 | 52706..52855 | + | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| H7R28_RS26710 | 53140..53388 | + | 249 | WP_000083839.1 | replication regulatory protein RepA | - |
| H7R28_RS26715 | 53633..53707 | + | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| H7R28_RS26720 | 53700..54557 | + | 858 | WP_016240488.1 | incFII family plasmid replication initiator RepA | - |
| H7R28_RS26725 | 55472..55741 | + | 270 | WP_000079928.1 | hypothetical protein | - |
| H7R28_RS26730 | 55738..56019 | + | 282 | WP_000970000.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| H7R28_RS26735 | 56065..56913 | + | 849 | WP_032256585.1 | 3'-5' exonuclease | - |
| H7R28_RS26740 | 57030..57512 | + | 483 | WP_001311056.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..77891 | 77891 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T34389 WP_001312851.1 NZ_AP022072:52706-52855 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T34389 NZ_AP022072:52706-52855 [Escherichia coli]
ATGACGAAGTATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAGTATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT34389 NZ_AP022072:c52661-52602 [Escherichia coli]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|