Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 44274..44538 | Replicon | plasmid pWP4-W18-ESBL-08_2 |
Accession | NZ_AP022066 | ||
Organism | Escherichia coli strain WP4-W18-ESBL-08 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Y6M3 |
Locus tag | H7R03_RS24915 | Protein ID | WP_001331364.1 |
Coordinates | 44274..44426 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 44476..44538 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H7R03_RS24890 | 39551..41719 | + | 2169 | WP_021537350.1 | DotA/TraY family protein | - |
H7R03_RS24895 | 41793..42443 | + | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
H7R03_RS24900 | 42515..42724 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
H7R03_RS24905 | 43116..43292 | + | 177 | WP_001054904.1 | hypothetical protein | - |
H7R03_RS24910 | 43951..44202 | + | 252 | WP_001291964.1 | hypothetical protein | - |
H7R03_RS24915 | 44274..44426 | - | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
- | 44476..44538 | + | 63 | NuclAT_0 | - | Antitoxin |
- | 44476..44538 | + | 63 | NuclAT_0 | - | Antitoxin |
- | 44476..44538 | + | 63 | NuclAT_0 | - | Antitoxin |
- | 44476..44538 | + | 63 | NuclAT_0 | - | Antitoxin |
H7R03_RS24920 | 44718..45926 | + | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
H7R03_RS24925 | 45945..47015 | + | 1071 | WP_000151576.1 | IncI1-type conjugal transfer protein TrbB | - |
H7R03_RS24930 | 47008..49299 | + | 2292 | WP_001289270.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..95805 | 95805 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T34347 WP_001331364.1 NZ_AP022066:c44426-44274 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T34347 NZ_AP022066:c44426-44274 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT34347 NZ_AP022066:44476-44538 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|