Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 64121..64363 | Replicon | plasmid pWP4-W18-ESBL-08_1 |
Accession | NZ_AP022065 | ||
Organism | Escherichia coli strain WP4-W18-ESBL-08 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | H7R03_RS24245 | Protein ID | WP_001312861.1 |
Coordinates | 64205..64363 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 64121..64161 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H7R03_RS24225 | 59316..61274 | + | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
H7R03_RS24230 | 61329..61763 | + | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
H7R03_RS24235 | 61760..62479 | + | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
- | 62491..62677 | + | 187 | NuclAT_0 | - | - |
- | 62491..62677 | + | 187 | NuclAT_0 | - | - |
- | 62491..62677 | + | 187 | NuclAT_0 | - | - |
- | 62491..62677 | + | 187 | NuclAT_0 | - | - |
H7R03_RS24240 | 62725..64094 | + | 1370 | WP_085947770.1 | IS3-like element IS150 family transposase | - |
- | 64121..64161 | + | 41 | NuclAT_1 | - | Antitoxin |
- | 64121..64161 | + | 41 | NuclAT_1 | - | Antitoxin |
- | 64121..64161 | + | 41 | NuclAT_1 | - | Antitoxin |
- | 64121..64161 | + | 41 | NuclAT_1 | - | Antitoxin |
H7R03_RS24245 | 64205..64363 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
H7R03_RS24250 | 64806..65141 | + | 336 | WP_013023876.1 | hypothetical protein | - |
H7R03_RS24255 | 65054..65260 | + | 207 | WP_000275859.1 | hypothetical protein | - |
H7R03_RS24260 | 65285..65572 | + | 288 | WP_000107535.1 | hypothetical protein | - |
H7R03_RS24265 | 65691..66512 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
H7R03_RS24270 | 66809..67411 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
H7R03_RS24275 | 67742..68125 | + | 384 | WP_001151566.1 | relaxosome protein TraM | - |
H7R03_RS24280 | 68259..68936 | + | 678 | WP_001348626.1 | PAS domain-containing protein | - |
H7R03_RS24285 | 69024..69251 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-27 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17 | senB | 1..134864 | 134864 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T34339 WP_001312861.1 NZ_AP022065:64205-64363 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T34339 NZ_AP022065:64205-64363 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 41 bp
>AT34339 NZ_AP022065:64121-64161 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|