Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 2078488..2078709 | Replicon | chromosome |
Accession | NZ_AP022064 | ||
Organism | Escherichia coli strain WP4-W18-ESBL-08 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | A0A1U9U3P9 |
Locus tag | H7R03_RS10200 | Protein ID | WP_001531632.1 |
Coordinates | 2078488..2078595 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 2078643..2078709 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H7R03_RS10170 | 2073704..2074096 | + | 393 | WP_000200375.1 | invasion regulator SirB2 | - |
H7R03_RS10175 | 2074100..2074909 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
H7R03_RS10180 | 2074945..2075799 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
H7R03_RS10185 | 2075926..2077539 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
H7R03_RS10190 | 2077570..2077920 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
H7R03_RS10195 | 2077917..2078342 | - | 426 | WP_000422741.1 | IS66 family insertion sequence hypothetical protein | - |
H7R03_RS10200 | 2078488..2078595 | - | 108 | WP_001531632.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 2078643..2078709 | + | 67 | NuclAT_10 | - | Antitoxin |
- | 2078643..2078709 | + | 67 | NuclAT_10 | - | Antitoxin |
- | 2078643..2078709 | + | 67 | NuclAT_10 | - | Antitoxin |
- | 2078643..2078709 | + | 67 | NuclAT_10 | - | Antitoxin |
- | 2078643..2078709 | + | 67 | NuclAT_5 | - | Antitoxin |
- | 2078643..2078709 | + | 67 | NuclAT_5 | - | Antitoxin |
- | 2078643..2078709 | + | 67 | NuclAT_5 | - | Antitoxin |
- | 2078643..2078709 | + | 67 | NuclAT_5 | - | Antitoxin |
- | 2078643..2078709 | + | 67 | NuclAT_6 | - | Antitoxin |
- | 2078643..2078709 | + | 67 | NuclAT_6 | - | Antitoxin |
- | 2078643..2078709 | + | 67 | NuclAT_6 | - | Antitoxin |
- | 2078643..2078709 | + | 67 | NuclAT_6 | - | Antitoxin |
- | 2078643..2078709 | + | 67 | NuclAT_7 | - | Antitoxin |
- | 2078643..2078709 | + | 67 | NuclAT_7 | - | Antitoxin |
- | 2078643..2078709 | + | 67 | NuclAT_7 | - | Antitoxin |
- | 2078643..2078709 | + | 67 | NuclAT_7 | - | Antitoxin |
- | 2078643..2078709 | + | 67 | NuclAT_8 | - | Antitoxin |
- | 2078643..2078709 | + | 67 | NuclAT_8 | - | Antitoxin |
- | 2078643..2078709 | + | 67 | NuclAT_8 | - | Antitoxin |
- | 2078643..2078709 | + | 67 | NuclAT_8 | - | Antitoxin |
- | 2078643..2078709 | + | 67 | NuclAT_9 | - | Antitoxin |
- | 2078643..2078709 | + | 67 | NuclAT_9 | - | Antitoxin |
- | 2078643..2078709 | + | 67 | NuclAT_9 | - | Antitoxin |
- | 2078643..2078709 | + | 67 | NuclAT_9 | - | Antitoxin |
- | 2078645..2078708 | + | 64 | NuclAT_12 | - | - |
- | 2078645..2078708 | + | 64 | NuclAT_12 | - | - |
- | 2078645..2078708 | + | 64 | NuclAT_12 | - | - |
- | 2078645..2078708 | + | 64 | NuclAT_12 | - | - |
- | 2078645..2078708 | + | 64 | NuclAT_13 | - | - |
- | 2078645..2078708 | + | 64 | NuclAT_13 | - | - |
- | 2078645..2078708 | + | 64 | NuclAT_13 | - | - |
- | 2078645..2078708 | + | 64 | NuclAT_13 | - | - |
- | 2078645..2078708 | + | 64 | NuclAT_14 | - | - |
- | 2078645..2078708 | + | 64 | NuclAT_14 | - | - |
- | 2078645..2078708 | + | 64 | NuclAT_14 | - | - |
- | 2078645..2078708 | + | 64 | NuclAT_14 | - | - |
- | 2078645..2078708 | + | 64 | NuclAT_15 | - | - |
- | 2078645..2078708 | + | 64 | NuclAT_15 | - | - |
- | 2078645..2078708 | + | 64 | NuclAT_15 | - | - |
- | 2078645..2078708 | + | 64 | NuclAT_15 | - | - |
- | 2078645..2078708 | + | 64 | NuclAT_16 | - | - |
- | 2078645..2078708 | + | 64 | NuclAT_16 | - | - |
- | 2078645..2078708 | + | 64 | NuclAT_16 | - | - |
- | 2078645..2078708 | + | 64 | NuclAT_16 | - | - |
- | 2078645..2078708 | + | 64 | NuclAT_17 | - | - |
- | 2078645..2078708 | + | 64 | NuclAT_17 | - | - |
- | 2078645..2078708 | + | 64 | NuclAT_17 | - | - |
- | 2078645..2078708 | + | 64 | NuclAT_17 | - | - |
- | 2078645..2078710 | + | 66 | NuclAT_18 | - | - |
- | 2078645..2078710 | + | 66 | NuclAT_18 | - | - |
- | 2078645..2078710 | + | 66 | NuclAT_18 | - | - |
- | 2078645..2078710 | + | 66 | NuclAT_18 | - | - |
- | 2078645..2078710 | + | 66 | NuclAT_19 | - | - |
- | 2078645..2078710 | + | 66 | NuclAT_19 | - | - |
- | 2078645..2078710 | + | 66 | NuclAT_19 | - | - |
- | 2078645..2078710 | + | 66 | NuclAT_19 | - | - |
- | 2078645..2078710 | + | 66 | NuclAT_20 | - | - |
- | 2078645..2078710 | + | 66 | NuclAT_20 | - | - |
- | 2078645..2078710 | + | 66 | NuclAT_20 | - | - |
- | 2078645..2078710 | + | 66 | NuclAT_20 | - | - |
- | 2078645..2078710 | + | 66 | NuclAT_21 | - | - |
- | 2078645..2078710 | + | 66 | NuclAT_21 | - | - |
- | 2078645..2078710 | + | 66 | NuclAT_21 | - | - |
- | 2078645..2078710 | + | 66 | NuclAT_21 | - | - |
- | 2078645..2078710 | + | 66 | NuclAT_22 | - | - |
- | 2078645..2078710 | + | 66 | NuclAT_22 | - | - |
- | 2078645..2078710 | + | 66 | NuclAT_22 | - | - |
- | 2078645..2078710 | + | 66 | NuclAT_22 | - | - |
- | 2078645..2078710 | + | 66 | NuclAT_23 | - | - |
- | 2078645..2078710 | + | 66 | NuclAT_23 | - | - |
- | 2078645..2078710 | + | 66 | NuclAT_23 | - | - |
- | 2078645..2078710 | + | 66 | NuclAT_23 | - | - |
H7R03_RS10205 | 2079000..2080100 | - | 1101 | WP_000063608.1 | sodium-potassium/proton antiporter ChaA | - |
H7R03_RS10210 | 2080370..2080609 | + | 240 | WP_000120702.1 | putative cation transport regulator ChaB | - |
H7R03_RS10215 | 2080758..2081453 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
H7R03_RS10220 | 2081497..2081850 | - | 354 | WP_001169659.1 | DsrE/F sulfur relay family protein YchN | - |
H7R03_RS10225 | 2082035..2083429 | + | 1395 | WP_000086187.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4040.89 Da Isoelectric Point: 12.5163
>T34315 WP_001531632.1 NZ_AP022064:c2078595-2078488 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK
Download Length: 108 bp
>T34315 NZ_AP022064:c2078595-2078488 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACAACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACAACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT34315 NZ_AP022064:2078643-2078709 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|