Detailed information of TA system TA034315

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 2078488..2078709
• Replicon: chromosome
• Accession: NZ_AP022064
• Organism: Escherichia coli strain WP4-W18-ESBL-08

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: A0A1U9U3P9
• Locus tag: H7R03_RS10200
• Protein ID: WP_001531632.1
• Coordinates: 2078488..2078595 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	2078643..2078709 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
H7R03_RS10170	2073704..2074096	+	393	WP_000200375.1	invasion regulator SirB2	-
H7R03_RS10175	2074100..2074909	+	810	WP_001257044.1	invasion regulator SirB1	-
H7R03_RS10180	2074945..2075799	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
H7R03_RS10185	2075926..2077539	-	1614	WP_000080195.1	IS66-like element ISEc23 family transposase	-
H7R03_RS10190	2077570..2077920	-	351	WP_000624722.1	IS66 family insertion sequence element accessory protein TnpB	-
H7R03_RS10195	2077917..2078342	-	426	WP_000422741.1	IS66 family insertion sequence hypothetical protein	-
H7R03_RS10200	2078488..2078595	-	108	WP_001531632.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	2078643..2078709	+	67	NuclAT_10	-	Antitoxin
-	2078643..2078709	+	67	NuclAT_10	-	Antitoxin
-	2078643..2078709	+	67	NuclAT_10	-	Antitoxin
-	2078643..2078709	+	67	NuclAT_10	-	Antitoxin
-	2078643..2078709	+	67	NuclAT_5	-	Antitoxin
-	2078643..2078709	+	67	NuclAT_5	-	Antitoxin
-	2078643..2078709	+	67	NuclAT_5	-	Antitoxin
-	2078643..2078709	+	67	NuclAT_5	-	Antitoxin
-	2078643..2078709	+	67	NuclAT_6	-	Antitoxin
-	2078643..2078709	+	67	NuclAT_6	-	Antitoxin
-	2078643..2078709	+	67	NuclAT_6	-	Antitoxin
-	2078643..2078709	+	67	NuclAT_6	-	Antitoxin
-	2078643..2078709	+	67	NuclAT_7	-	Antitoxin
-	2078643..2078709	+	67	NuclAT_7	-	Antitoxin
-	2078643..2078709	+	67	NuclAT_7	-	Antitoxin
-	2078643..2078709	+	67	NuclAT_7	-	Antitoxin
-	2078643..2078709	+	67	NuclAT_8	-	Antitoxin
-	2078643..2078709	+	67	NuclAT_8	-	Antitoxin
-	2078643..2078709	+	67	NuclAT_8	-	Antitoxin
-	2078643..2078709	+	67	NuclAT_8	-	Antitoxin
-	2078643..2078709	+	67	NuclAT_9	-	Antitoxin
-	2078643..2078709	+	67	NuclAT_9	-	Antitoxin
-	2078643..2078709	+	67	NuclAT_9	-	Antitoxin
-	2078643..2078709	+	67	NuclAT_9	-	Antitoxin
-	2078645..2078708	+	64	NuclAT_12	-	-
-	2078645..2078708	+	64	NuclAT_12	-	-
-	2078645..2078708	+	64	NuclAT_12	-	-
-	2078645..2078708	+	64	NuclAT_12	-	-
-	2078645..2078708	+	64	NuclAT_13	-	-
-	2078645..2078708	+	64	NuclAT_13	-	-
-	2078645..2078708	+	64	NuclAT_13	-	-
-	2078645..2078708	+	64	NuclAT_13	-	-
-	2078645..2078708	+	64	NuclAT_14	-	-
-	2078645..2078708	+	64	NuclAT_14	-	-
-	2078645..2078708	+	64	NuclAT_14	-	-
-	2078645..2078708	+	64	NuclAT_14	-	-
-	2078645..2078708	+	64	NuclAT_15	-	-
-	2078645..2078708	+	64	NuclAT_15	-	-
-	2078645..2078708	+	64	NuclAT_15	-	-
-	2078645..2078708	+	64	NuclAT_15	-	-
-	2078645..2078708	+	64	NuclAT_16	-	-
-	2078645..2078708	+	64	NuclAT_16	-	-
-	2078645..2078708	+	64	NuclAT_16	-	-
-	2078645..2078708	+	64	NuclAT_16	-	-
-	2078645..2078708	+	64	NuclAT_17	-	-
-	2078645..2078708	+	64	NuclAT_17	-	-
-	2078645..2078708	+	64	NuclAT_17	-	-
-	2078645..2078708	+	64	NuclAT_17	-	-
-	2078645..2078710	+	66	NuclAT_18	-	-
-	2078645..2078710	+	66	NuclAT_18	-	-
-	2078645..2078710	+	66	NuclAT_18	-	-
-	2078645..2078710	+	66	NuclAT_18	-	-
-	2078645..2078710	+	66	NuclAT_19	-	-
-	2078645..2078710	+	66	NuclAT_19	-	-
-	2078645..2078710	+	66	NuclAT_19	-	-
-	2078645..2078710	+	66	NuclAT_19	-	-
-	2078645..2078710	+	66	NuclAT_20	-	-
-	2078645..2078710	+	66	NuclAT_20	-	-
-	2078645..2078710	+	66	NuclAT_20	-	-
-	2078645..2078710	+	66	NuclAT_20	-	-
-	2078645..2078710	+	66	NuclAT_21	-	-
-	2078645..2078710	+	66	NuclAT_21	-	-
-	2078645..2078710	+	66	NuclAT_21	-	-
-	2078645..2078710	+	66	NuclAT_21	-	-
-	2078645..2078710	+	66	NuclAT_22	-	-
-	2078645..2078710	+	66	NuclAT_22	-	-
-	2078645..2078710	+	66	NuclAT_22	-	-
-	2078645..2078710	+	66	NuclAT_22	-	-
-	2078645..2078710	+	66	NuclAT_23	-	-
-	2078645..2078710	+	66	NuclAT_23	-	-
-	2078645..2078710	+	66	NuclAT_23	-	-
-	2078645..2078710	+	66	NuclAT_23	-	-
H7R03_RS10205	2079000..2080100	-	1101	WP_000063608.1	sodium-potassium/proton antiporter ChaA	-
H7R03_RS10210	2080370..2080609	+	240	WP_000120702.1	putative cation transport regulator ChaB	-
H7R03_RS10215	2080758..2081453	+	696	WP_001295621.1	glutathione-specific gamma-glutamylcyclotransferase	-
H7R03_RS10220	2081497..2081850	-	354	WP_001169659.1	DsrE/F sulfur relay family protein YchN	-
H7R03_RS10225	2082035..2083429	+	1395	WP_000086187.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4040.89 Da
• Isoelectric Point: 12.5163

>T34315 WP_001531632.1 NZ_AP022064:c2078595-2078488 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Nucleotide

• Length: 108 bp

>T34315 NZ_AP022064:c2078595-2078488 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACAACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 67 bp

>AT34315 NZ_AP022064:2078643-2078709 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Structures

Toxin

• AlphaFold DB: A0A1U9U3P9

Antitoxin