Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2681259..2681479 | Replicon | chromosome |
| Accession | NZ_AP022036 | ||
| Organism | Escherichia coli strain WP3-S18-ESBL-09 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | J7R083 |
| Locus tag | H7R01_RS12945 | Protein ID | WP_000170963.1 |
| Coordinates | 2681372..2681479 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2681259..2681325 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7R01_RS12920 | 2676538..2677932 | - | 1395 | WP_000086213.1 | inverse autotransporter invasin YchO | - |
| H7R01_RS12925 | 2678117..2678470 | + | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| H7R01_RS12930 | 2678514..2679209 | - | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| H7R01_RS12935 | 2679367..2679597 | - | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| H7R01_RS12940 | 2679867..2680967 | + | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| - | 2681259..2681325 | - | 67 | - | - | Antitoxin |
| H7R01_RS12945 | 2681372..2681479 | + | 108 | WP_000170963.1 | small toxic polypeptide LdrB | Toxin |
| - | 2681792..2681855 | - | 64 | NuclAT_38 | - | - |
| - | 2681792..2681855 | - | 64 | NuclAT_38 | - | - |
| - | 2681792..2681855 | - | 64 | NuclAT_38 | - | - |
| - | 2681792..2681855 | - | 64 | NuclAT_38 | - | - |
| - | 2681792..2681855 | - | 64 | NuclAT_40 | - | - |
| - | 2681792..2681855 | - | 64 | NuclAT_40 | - | - |
| - | 2681792..2681855 | - | 64 | NuclAT_40 | - | - |
| - | 2681792..2681855 | - | 64 | NuclAT_40 | - | - |
| - | 2681792..2681855 | - | 64 | NuclAT_42 | - | - |
| - | 2681792..2681855 | - | 64 | NuclAT_42 | - | - |
| - | 2681792..2681855 | - | 64 | NuclAT_42 | - | - |
| - | 2681792..2681855 | - | 64 | NuclAT_42 | - | - |
| - | 2681792..2681855 | - | 64 | NuclAT_44 | - | - |
| - | 2681792..2681855 | - | 64 | NuclAT_44 | - | - |
| - | 2681792..2681855 | - | 64 | NuclAT_44 | - | - |
| - | 2681792..2681855 | - | 64 | NuclAT_44 | - | - |
| - | 2681792..2681855 | - | 64 | NuclAT_46 | - | - |
| - | 2681792..2681855 | - | 64 | NuclAT_46 | - | - |
| - | 2681792..2681855 | - | 64 | NuclAT_46 | - | - |
| - | 2681792..2681855 | - | 64 | NuclAT_46 | - | - |
| - | 2681792..2681855 | - | 64 | NuclAT_48 | - | - |
| - | 2681792..2681855 | - | 64 | NuclAT_48 | - | - |
| - | 2681792..2681855 | - | 64 | NuclAT_48 | - | - |
| - | 2681792..2681855 | - | 64 | NuclAT_48 | - | - |
| - | 2681794..2681855 | - | 62 | NuclAT_17 | - | - |
| - | 2681794..2681855 | - | 62 | NuclAT_17 | - | - |
| - | 2681794..2681855 | - | 62 | NuclAT_17 | - | - |
| - | 2681794..2681855 | - | 62 | NuclAT_17 | - | - |
| - | 2681794..2681855 | - | 62 | NuclAT_20 | - | - |
| - | 2681794..2681855 | - | 62 | NuclAT_20 | - | - |
| - | 2681794..2681855 | - | 62 | NuclAT_20 | - | - |
| - | 2681794..2681855 | - | 62 | NuclAT_20 | - | - |
| - | 2681794..2681855 | - | 62 | NuclAT_23 | - | - |
| - | 2681794..2681855 | - | 62 | NuclAT_23 | - | - |
| - | 2681794..2681855 | - | 62 | NuclAT_23 | - | - |
| - | 2681794..2681855 | - | 62 | NuclAT_23 | - | - |
| - | 2681794..2681855 | - | 62 | NuclAT_26 | - | - |
| - | 2681794..2681855 | - | 62 | NuclAT_26 | - | - |
| - | 2681794..2681855 | - | 62 | NuclAT_26 | - | - |
| - | 2681794..2681855 | - | 62 | NuclAT_26 | - | - |
| - | 2681794..2681855 | - | 62 | NuclAT_32 | - | - |
| - | 2681794..2681855 | - | 62 | NuclAT_32 | - | - |
| - | 2681794..2681855 | - | 62 | NuclAT_32 | - | - |
| - | 2681794..2681855 | - | 62 | NuclAT_32 | - | - |
| - | 2681794..2681855 | - | 62 | NuclAT_35 | - | - |
| - | 2681794..2681855 | - | 62 | NuclAT_35 | - | - |
| - | 2681794..2681855 | - | 62 | NuclAT_35 | - | - |
| - | 2681794..2681855 | - | 62 | NuclAT_35 | - | - |
| H7R01_RS12950 | 2681908..2682015 | + | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2682330..2682393 | - | 64 | NuclAT_18 | - | - |
| - | 2682330..2682393 | - | 64 | NuclAT_18 | - | - |
| - | 2682330..2682393 | - | 64 | NuclAT_18 | - | - |
| - | 2682330..2682393 | - | 64 | NuclAT_18 | - | - |
| - | 2682330..2682393 | - | 64 | NuclAT_21 | - | - |
| - | 2682330..2682393 | - | 64 | NuclAT_21 | - | - |
| - | 2682330..2682393 | - | 64 | NuclAT_21 | - | - |
| - | 2682330..2682393 | - | 64 | NuclAT_21 | - | - |
| - | 2682330..2682393 | - | 64 | NuclAT_24 | - | - |
| - | 2682330..2682393 | - | 64 | NuclAT_24 | - | - |
| - | 2682330..2682393 | - | 64 | NuclAT_24 | - | - |
| - | 2682330..2682393 | - | 64 | NuclAT_24 | - | - |
| - | 2682330..2682393 | - | 64 | NuclAT_27 | - | - |
| - | 2682330..2682393 | - | 64 | NuclAT_27 | - | - |
| - | 2682330..2682393 | - | 64 | NuclAT_27 | - | - |
| - | 2682330..2682393 | - | 64 | NuclAT_27 | - | - |
| - | 2682330..2682393 | - | 64 | NuclAT_33 | - | - |
| - | 2682330..2682393 | - | 64 | NuclAT_33 | - | - |
| - | 2682330..2682393 | - | 64 | NuclAT_33 | - | - |
| - | 2682330..2682393 | - | 64 | NuclAT_33 | - | - |
| - | 2682330..2682393 | - | 64 | NuclAT_36 | - | - |
| - | 2682330..2682393 | - | 64 | NuclAT_36 | - | - |
| - | 2682330..2682393 | - | 64 | NuclAT_36 | - | - |
| - | 2682330..2682393 | - | 64 | NuclAT_36 | - | - |
| H7R01_RS12955 | 2682443..2682550 | + | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| H7R01_RS12960 | 2682699..2683553 | - | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| H7R01_RS12965 | 2683589..2684398 | - | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| H7R01_RS12970 | 2684402..2684794 | - | 393 | WP_000200392.1 | invasion regulator SirB2 | - |
| H7R01_RS12975 | 2684791..2685624 | - | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T34212 WP_000170963.1 NZ_AP022036:2681372-2681479 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T34212 NZ_AP022036:2681372-2681479 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT34212 NZ_AP022036:c2681325-2681259 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|