Detailed information of TA system TA034212

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 2681259..2681479
• Replicon: chromosome
• Accession: NZ_AP022036
• Organism: Escherichia coli strain WP3-S18-ESBL-09

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: J7R083
• Locus tag: H7R01_RS12945
• Protein ID: WP_000170963.1
• Coordinates: 2681372..2681479 (+)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	2681259..2681325 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
H7R01_RS12920	2676538..2677932	-	1395	WP_000086213.1	inverse autotransporter invasin YchO	-
H7R01_RS12925	2678117..2678470	+	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-
H7R01_RS12930	2678514..2679209	-	696	WP_001297117.1	glutathione-specific gamma-glutamylcyclotransferase	-
H7R01_RS12935	2679367..2679597	-	231	WP_001146442.1	putative cation transport regulator ChaB	-
H7R01_RS12940	2679867..2680967	+	1101	WP_001295620.1	sodium-potassium/proton antiporter ChaA	-
-	2681259..2681325	-	67	-	-	Antitoxin
H7R01_RS12945	2681372..2681479	+	108	WP_000170963.1	small toxic polypeptide LdrB	Toxin
-	2681792..2681855	-	64	NuclAT_38	-	-
-	2681792..2681855	-	64	NuclAT_38	-	-
-	2681792..2681855	-	64	NuclAT_38	-	-
-	2681792..2681855	-	64	NuclAT_38	-	-
-	2681792..2681855	-	64	NuclAT_40	-	-
-	2681792..2681855	-	64	NuclAT_40	-	-
-	2681792..2681855	-	64	NuclAT_40	-	-
-	2681792..2681855	-	64	NuclAT_40	-	-
-	2681792..2681855	-	64	NuclAT_42	-	-
-	2681792..2681855	-	64	NuclAT_42	-	-
-	2681792..2681855	-	64	NuclAT_42	-	-
-	2681792..2681855	-	64	NuclAT_42	-	-
-	2681792..2681855	-	64	NuclAT_44	-	-
-	2681792..2681855	-	64	NuclAT_44	-	-
-	2681792..2681855	-	64	NuclAT_44	-	-
-	2681792..2681855	-	64	NuclAT_44	-	-
-	2681792..2681855	-	64	NuclAT_46	-	-
-	2681792..2681855	-	64	NuclAT_46	-	-
-	2681792..2681855	-	64	NuclAT_46	-	-
-	2681792..2681855	-	64	NuclAT_46	-	-
-	2681792..2681855	-	64	NuclAT_48	-	-
-	2681792..2681855	-	64	NuclAT_48	-	-
-	2681792..2681855	-	64	NuclAT_48	-	-
-	2681792..2681855	-	64	NuclAT_48	-	-
-	2681794..2681855	-	62	NuclAT_17	-	-
-	2681794..2681855	-	62	NuclAT_17	-	-
-	2681794..2681855	-	62	NuclAT_17	-	-
-	2681794..2681855	-	62	NuclAT_17	-	-
-	2681794..2681855	-	62	NuclAT_20	-	-
-	2681794..2681855	-	62	NuclAT_20	-	-
-	2681794..2681855	-	62	NuclAT_20	-	-
-	2681794..2681855	-	62	NuclAT_20	-	-
-	2681794..2681855	-	62	NuclAT_23	-	-
-	2681794..2681855	-	62	NuclAT_23	-	-
-	2681794..2681855	-	62	NuclAT_23	-	-
-	2681794..2681855	-	62	NuclAT_23	-	-
-	2681794..2681855	-	62	NuclAT_26	-	-
-	2681794..2681855	-	62	NuclAT_26	-	-
-	2681794..2681855	-	62	NuclAT_26	-	-
-	2681794..2681855	-	62	NuclAT_26	-	-
-	2681794..2681855	-	62	NuclAT_32	-	-
-	2681794..2681855	-	62	NuclAT_32	-	-
-	2681794..2681855	-	62	NuclAT_32	-	-
-	2681794..2681855	-	62	NuclAT_32	-	-
-	2681794..2681855	-	62	NuclAT_35	-	-
-	2681794..2681855	-	62	NuclAT_35	-	-
-	2681794..2681855	-	62	NuclAT_35	-	-
-	2681794..2681855	-	62	NuclAT_35	-	-
H7R01_RS12950	2681908..2682015	+	108	WP_000170926.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	2682330..2682393	-	64	NuclAT_18	-	-
-	2682330..2682393	-	64	NuclAT_18	-	-
-	2682330..2682393	-	64	NuclAT_18	-	-
-	2682330..2682393	-	64	NuclAT_18	-	-
-	2682330..2682393	-	64	NuclAT_21	-	-
-	2682330..2682393	-	64	NuclAT_21	-	-
-	2682330..2682393	-	64	NuclAT_21	-	-
-	2682330..2682393	-	64	NuclAT_21	-	-
-	2682330..2682393	-	64	NuclAT_24	-	-
-	2682330..2682393	-	64	NuclAT_24	-	-
-	2682330..2682393	-	64	NuclAT_24	-	-
-	2682330..2682393	-	64	NuclAT_24	-	-
-	2682330..2682393	-	64	NuclAT_27	-	-
-	2682330..2682393	-	64	NuclAT_27	-	-
-	2682330..2682393	-	64	NuclAT_27	-	-
-	2682330..2682393	-	64	NuclAT_27	-	-
-	2682330..2682393	-	64	NuclAT_33	-	-
-	2682330..2682393	-	64	NuclAT_33	-	-
-	2682330..2682393	-	64	NuclAT_33	-	-
-	2682330..2682393	-	64	NuclAT_33	-	-
-	2682330..2682393	-	64	NuclAT_36	-	-
-	2682330..2682393	-	64	NuclAT_36	-	-
-	2682330..2682393	-	64	NuclAT_36	-	-
-	2682330..2682393	-	64	NuclAT_36	-	-
H7R01_RS12955	2682443..2682550	+	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
H7R01_RS12960	2682699..2683553	-	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
H7R01_RS12965	2683589..2684398	-	810	WP_001257044.1	invasion regulator SirB1	-
H7R01_RS12970	2684402..2684794	-	393	WP_000200392.1	invasion regulator SirB2	-
H7R01_RS12975	2684791..2685624	-	834	WP_000456571.1	peptide chain release factor N(5)-glutamine methyltransferase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3971.74 Da
• Isoelectric Point: 11.4779

>T34212 WP_000170963.1 NZ_AP022036:2681372-2681479 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Nucleotide

• Length: 108 bp

>T34212 NZ_AP022036:2681372-2681479 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 67 bp

>AT34212 NZ_AP022036:c2681325-2681259 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Antitoxin