Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 79884..80123 | Replicon | plasmid pWP3-S18-ESBL-08_1 |
Accession | NZ_AP022033 | ||
Organism | Escherichia coli strain WP3-S18-ESBL-08 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | A0A762TWR7 |
Locus tag | H7R15_RS24295 | Protein ID | WP_023144756.1 |
Coordinates | 79989..80123 (+) | Length | 45 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 79884..79944 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H7R15_RS24265 | 75675..76235 | + | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
H7R15_RS24270 | 76366..76578 | + | 213 | WP_013023861.1 | hypothetical protein | - |
H7R15_RS24275 | 77137..77562 | + | 426 | WP_000422741.1 | IS66 family insertion sequence hypothetical protein | - |
H7R15_RS24280 | 77559..77909 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
H7R15_RS24285 | 77940..79553 | + | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
H7R15_RS24290 | 79631..79917 | + | 287 | Protein_85 | DUF2726 domain-containing protein | - |
- | 79884..79944 | - | 61 | NuclAT_1 | - | Antitoxin |
- | 79884..79944 | - | 61 | NuclAT_1 | - | Antitoxin |
- | 79884..79944 | - | 61 | NuclAT_1 | - | Antitoxin |
- | 79884..79944 | - | 61 | NuclAT_1 | - | Antitoxin |
H7R15_RS24295 | 79989..80123 | + | 135 | WP_023144756.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
H7R15_RS24300 | 80420..80674 | + | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
H7R15_RS24535 | 80780..80914 | + | 135 | Protein_88 | protein CopA/IncA | - |
H7R15_RS24305 | 80911..80985 | + | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
H7R15_RS24310 | 80978..81835 | + | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
H7R15_RS24315 | 82775..83428 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
H7R15_RS24320 | 83521..83778 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
H7R15_RS24325 | 83711..84112 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
H7R15_RS24330 | 84361..84776 | + | 416 | Protein_94 | IS1 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaCTX-M-27 | senB | 1..105867 | 105867 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T34192 WP_023144756.1 NZ_AP022033:79989-80123 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
>T34192 NZ_AP022033:79989-80123 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
Antitoxin
Download Length: 61 bp
>AT34192 NZ_AP022033:c79944-79884 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|