Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 72011..72264 | Replicon | plasmid pWP3-W18-ESBL-08_1 |
| Accession | NZ_AP022004 | ||
| Organism | Escherichia coli strain WP3-W18-ESBL-08 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A148HBD8 |
| Locus tag | H7R22_RS25580 | Protein ID | WP_001336447.1 |
| Coordinates | 72115..72264 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 72011..72067 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7R22_RS25555 | 67913..68659 | + | 747 | WP_000205709.1 | conjugal transfer pilus acetylase TraX | - |
| H7R22_RS25560 | 68714..69271 | + | 558 | WP_000139329.1 | fertility inhibition protein FinO | - |
| H7R22_RS25565 | 70379..70840 | + | 462 | WP_000760080.1 | thermonuclease family protein | - |
| H7R22_RS25570 | 70943..71326 | + | 384 | WP_001109264.1 | hypothetical protein | - |
| H7R22_RS25575 | 71479..71916 | + | 438 | WP_000872609.1 | hypothetical protein | - |
| - | 72011..72067 | - | 57 | NuclAT_1 | - | Antitoxin |
| - | 72011..72067 | - | 57 | NuclAT_1 | - | Antitoxin |
| - | 72011..72067 | - | 57 | NuclAT_1 | - | Antitoxin |
| - | 72011..72067 | - | 57 | NuclAT_1 | - | Antitoxin |
| H7R22_RS25580 | 72115..72264 | + | 150 | WP_001336447.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| H7R22_RS25585 | 72549..72806 | + | 258 | WP_000084404.1 | replication regulatory protein RepA | - |
| H7R22_RS25590 | 73040..73114 | + | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| H7R22_RS25595 | 73107..73964 | + | 858 | WP_001537577.1 | incFII family plasmid replication initiator RepA | - |
| H7R22_RS25600 | 74665..74877 | + | 213 | WP_001336932.1 | hypothetical protein | - |
| H7R22_RS25605 | 74992..75300 | - | 309 | Protein_94 | transposase | - |
| H7R22_RS25610 | 75493..75591 | + | 99 | WP_137491101.1 | transposase | - |
| H7R22_RS25615 | 75741..75989 | - | 249 | WP_000738203.1 | hypothetical protein | - |
| H7R22_RS25620 | 76019..76789 | - | 771 | WP_000712166.1 | molybdopterin-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | senB | 1..131334 | 131334 | |
| - | flank | IS/Tn | - | - | 74992..75258 | 266 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5572.69 Da Isoelectric Point: 8.7678
>T34095 WP_001336447.1 NZ_AP022004:72115-72264 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T34095 NZ_AP022004:72115-72264 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATACCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 57 bp
>AT34095 NZ_AP022004:c72067-72011 [Escherichia coli]
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|