Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 79878..80117 | Replicon | plasmid pWP3-W18-ESBL-07_1 |
| Accession | NZ_AP021999 | ||
| Organism | Escherichia coli strain WP3-W18-ESBL-07 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | H7Q99_RS24640 | Protein ID | WP_023144756.1 |
| Coordinates | 79983..80117 (+) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 79878..79938 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7Q99_RS24610 | 75669..76229 | + | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| H7Q99_RS24615 | 76360..76572 | + | 213 | WP_013023861.1 | hypothetical protein | - |
| H7Q99_RS24620 | 77131..77556 | + | 426 | WP_000422741.1 | IS66 family insertion sequence hypothetical protein | - |
| H7Q99_RS24625 | 77553..77903 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| H7Q99_RS24630 | 77934..79547 | + | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| H7Q99_RS24635 | 79625..79911 | + | 287 | Protein_85 | DUF2726 domain-containing protein | - |
| - | 79878..79938 | - | 61 | NuclAT_1 | - | Antitoxin |
| - | 79878..79938 | - | 61 | NuclAT_1 | - | Antitoxin |
| - | 79878..79938 | - | 61 | NuclAT_1 | - | Antitoxin |
| - | 79878..79938 | - | 61 | NuclAT_1 | - | Antitoxin |
| H7Q99_RS24640 | 79983..80117 | + | 135 | WP_023144756.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| H7Q99_RS24645 | 80414..80668 | + | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| H7Q99_RS24930 | 80774..80908 | + | 135 | Protein_88 | protein CopA/IncA | - |
| H7Q99_RS24650 | 80905..80979 | + | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| H7Q99_RS24655 | 80972..81829 | + | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
| H7Q99_RS24660 | 82769..83422 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| H7Q99_RS24665 | 83515..83772 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| H7Q99_RS24670 | 83705..84106 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| H7Q99_RS24675 | 84355..84770 | + | 416 | Protein_94 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaCTX-M-27 | senB | 1..105864 | 105864 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T34055 WP_023144756.1 NZ_AP021999:79983-80117 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
>T34055 NZ_AP021999:79983-80117 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
Antitoxin
Download Length: 61 bp
>AT34055 NZ_AP021999:c79938-79878 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|