Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 90220..90484 | Replicon | plasmid pWP2-S18-ESBL-08_2 |
Accession | NZ_AP021948 | ||
Organism | Escherichia coli strain WP2-S18-ESBL-08 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | E6BRV3 |
Locus tag | H7R07_RS26575 | Protein ID | WP_001303307.1 |
Coordinates | 90332..90484 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 90220..90282 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H7R07_RS26560 | 85459..87750 | - | 2292 | WP_024255997.1 | hypothetical protein | - |
H7R07_RS26565 | 87743..88813 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
H7R07_RS26570 | 88832..90040 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
- | 90220..90282 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 90220..90282 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 90220..90282 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 90220..90282 | - | 63 | NuclAT_0 | - | Antitoxin |
H7R07_RS26575 | 90332..90484 | + | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
H7R07_RS26580 | 90556..90807 | - | 252 | WP_001291965.1 | hypothetical protein | - |
- | 91194..91245 | - | 52 | NuclAT_1 | - | - |
- | 91194..91245 | - | 52 | NuclAT_1 | - | - |
- | 91194..91245 | - | 52 | NuclAT_1 | - | - |
- | 91194..91245 | - | 52 | NuclAT_1 | - | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-8 | - | 1..91630 | 91630 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T33919 WP_001303307.1 NZ_AP021948:90332-90484 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T33919 NZ_AP021948:90332-90484 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT33919 NZ_AP021948:c90282-90220 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|