Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2091828..2092048 Replicon chromosome
Accession NZ_AP021933
Organism Escherichia coli strain WP2-W18-ESBL-08

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag H7R10_RS09705 Protein ID WP_000170954.1
Coordinates 2091828..2091935 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2091985..2092048 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H7R10_RS09680 2087672..2088754 + 1083 WP_000804726.1 peptide chain release factor 1 -
H7R10_RS09685 2088754..2089587 + 834 WP_000456458.1 peptide chain release factor N(5)-glutamine methyltransferase -
H7R10_RS09690 2089584..2089976 + 393 WP_000200374.1 invasion regulator SirB2 -
H7R10_RS09695 2089980..2090789 + 810 WP_001257044.1 invasion regulator SirB1 -
H7R10_RS09700 2090825..2091679 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
H7R10_RS09705 2091828..2091935 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2091985..2092048 + 64 NuclAT_51 - Antitoxin
- 2091985..2092048 + 64 NuclAT_51 - Antitoxin
- 2091985..2092048 + 64 NuclAT_51 - Antitoxin
- 2091985..2092048 + 64 NuclAT_51 - Antitoxin
- 2091985..2092048 + 64 NuclAT_54 - Antitoxin
- 2091985..2092048 + 64 NuclAT_54 - Antitoxin
- 2091985..2092048 + 64 NuclAT_54 - Antitoxin
- 2091985..2092048 + 64 NuclAT_54 - Antitoxin
- 2091985..2092048 + 64 NuclAT_57 - Antitoxin
- 2091985..2092048 + 64 NuclAT_57 - Antitoxin
- 2091985..2092048 + 64 NuclAT_57 - Antitoxin
- 2091985..2092048 + 64 NuclAT_57 - Antitoxin
- 2091985..2092048 + 64 NuclAT_60 - Antitoxin
- 2091985..2092048 + 64 NuclAT_60 - Antitoxin
- 2091985..2092048 + 64 NuclAT_60 - Antitoxin
- 2091985..2092048 + 64 NuclAT_60 - Antitoxin
H7R10_RS09710 2092363..2092470 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2092523..2092584 + 62 NuclAT_50 - -
- 2092523..2092584 + 62 NuclAT_50 - -
- 2092523..2092584 + 62 NuclAT_50 - -
- 2092523..2092584 + 62 NuclAT_50 - -
- 2092523..2092584 + 62 NuclAT_53 - -
- 2092523..2092584 + 62 NuclAT_53 - -
- 2092523..2092584 + 62 NuclAT_53 - -
- 2092523..2092584 + 62 NuclAT_53 - -
- 2092523..2092584 + 62 NuclAT_56 - -
- 2092523..2092584 + 62 NuclAT_56 - -
- 2092523..2092584 + 62 NuclAT_56 - -
- 2092523..2092584 + 62 NuclAT_56 - -
- 2092523..2092584 + 62 NuclAT_59 - -
- 2092523..2092584 + 62 NuclAT_59 - -
- 2092523..2092584 + 62 NuclAT_59 - -
- 2092523..2092584 + 62 NuclAT_59 - -
- 2092523..2092586 + 64 NuclAT_13 - -
- 2092523..2092586 + 64 NuclAT_13 - -
- 2092523..2092586 + 64 NuclAT_13 - -
- 2092523..2092586 + 64 NuclAT_13 - -
- 2092523..2092586 + 64 NuclAT_15 - -
- 2092523..2092586 + 64 NuclAT_15 - -
- 2092523..2092586 + 64 NuclAT_15 - -
- 2092523..2092586 + 64 NuclAT_15 - -
- 2092523..2092586 + 64 NuclAT_17 - -
- 2092523..2092586 + 64 NuclAT_17 - -
- 2092523..2092586 + 64 NuclAT_17 - -
- 2092523..2092586 + 64 NuclAT_17 - -
- 2092523..2092586 + 64 NuclAT_19 - -
- 2092523..2092586 + 64 NuclAT_19 - -
- 2092523..2092586 + 64 NuclAT_19 - -
- 2092523..2092586 + 64 NuclAT_19 - -
- 2092523..2092586 + 64 NuclAT_21 - -
- 2092523..2092586 + 64 NuclAT_21 - -
- 2092523..2092586 + 64 NuclAT_21 - -
- 2092523..2092586 + 64 NuclAT_21 - -
- 2092523..2092586 + 64 NuclAT_23 - -
- 2092523..2092586 + 64 NuclAT_23 - -
- 2092523..2092586 + 64 NuclAT_23 - -
- 2092523..2092586 + 64 NuclAT_23 - -
H7R10_RS09715 2092899..2093006 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2093054..2093119 + 66 NuclAT_49 - -
- 2093054..2093119 + 66 NuclAT_49 - -
- 2093054..2093119 + 66 NuclAT_49 - -
- 2093054..2093119 + 66 NuclAT_49 - -
- 2093054..2093119 + 66 NuclAT_52 - -
- 2093054..2093119 + 66 NuclAT_52 - -
- 2093054..2093119 + 66 NuclAT_52 - -
- 2093054..2093119 + 66 NuclAT_52 - -
- 2093054..2093119 + 66 NuclAT_55 - -
- 2093054..2093119 + 66 NuclAT_55 - -
- 2093054..2093119 + 66 NuclAT_55 - -
- 2093054..2093119 + 66 NuclAT_55 - -
- 2093054..2093119 + 66 NuclAT_58 - -
- 2093054..2093119 + 66 NuclAT_58 - -
- 2093054..2093119 + 66 NuclAT_58 - -
- 2093054..2093119 + 66 NuclAT_58 - -
- 2093054..2093121 + 68 NuclAT_12 - -
- 2093054..2093121 + 68 NuclAT_12 - -
- 2093054..2093121 + 68 NuclAT_12 - -
- 2093054..2093121 + 68 NuclAT_12 - -
- 2093054..2093121 + 68 NuclAT_14 - -
- 2093054..2093121 + 68 NuclAT_14 - -
- 2093054..2093121 + 68 NuclAT_14 - -
- 2093054..2093121 + 68 NuclAT_14 - -
- 2093054..2093121 + 68 NuclAT_16 - -
- 2093054..2093121 + 68 NuclAT_16 - -
- 2093054..2093121 + 68 NuclAT_16 - -
- 2093054..2093121 + 68 NuclAT_16 - -
- 2093054..2093121 + 68 NuclAT_18 - -
- 2093054..2093121 + 68 NuclAT_18 - -
- 2093054..2093121 + 68 NuclAT_18 - -
- 2093054..2093121 + 68 NuclAT_18 - -
- 2093054..2093121 + 68 NuclAT_20 - -
- 2093054..2093121 + 68 NuclAT_20 - -
- 2093054..2093121 + 68 NuclAT_20 - -
- 2093054..2093121 + 68 NuclAT_20 - -
- 2093054..2093121 + 68 NuclAT_22 - -
- 2093054..2093121 + 68 NuclAT_22 - -
- 2093054..2093121 + 68 NuclAT_22 - -
- 2093054..2093121 + 68 NuclAT_22 - -
H7R10_RS09720 2093411..2094511 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
H7R10_RS09725 2094781..2095011 + 231 WP_001146442.1 putative cation transport regulator ChaB -
H7R10_RS09730 2095169..2095864 + 696 WP_012311798.1 glutathione-specific gamma-glutamylcyclotransferase -
H7R10_RS09735 2095908..2096261 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T33786 WP_000170954.1 NZ_AP021933:c2091935-2091828 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T33786 NZ_AP021933:c2091935-2091828 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT33786 NZ_AP021933:2091985-2092048 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References