Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 40790..41054 | Replicon | plasmid pWP2-W18-CRE-03_2 |
| Accession | NZ_AP021916 | ||
| Organism | Escherichia coli strain WP2-W18-CRE-03 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | H7Q98_RS23875 | Protein ID | WP_001331364.1 |
| Coordinates | 40902..41054 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 40790..40847 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7Q98_RS23860 | 37128..38198 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
| H7Q98_RS23865 | 38217..39425 | - | 1209 | WP_001383960.1 | IncI1-type conjugal transfer protein TrbA | - |
| H7Q98_RS23870 | 39643..40629 | - | 987 | WP_001257838.1 | hypothetical protein | - |
| - | 40790..40847 | - | 58 | NuclAT_0 | - | Antitoxin |
| - | 40790..40847 | - | 58 | NuclAT_0 | - | Antitoxin |
| - | 40790..40847 | - | 58 | NuclAT_0 | - | Antitoxin |
| - | 40790..40847 | - | 58 | NuclAT_0 | - | Antitoxin |
| H7Q98_RS23875 | 40902..41054 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| H7Q98_RS23880 | 41126..41377 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| H7Q98_RS23885 | 42036..42212 | - | 177 | WP_001054900.1 | hypothetical protein | - |
| H7Q98_RS23890 | 42544..42753 | + | 210 | WP_000062602.1 | HEAT repeat domain-containing protein | - |
| H7Q98_RS23895 | 42825..43487 | - | 663 | WP_000644792.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| H7Q98_RS23900 | 43552..45720 | - | 2169 | WP_000698366.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..87852 | 87852 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T33746 WP_001331364.1 NZ_AP021916:40902-41054 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T33746 NZ_AP021916:40902-41054 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 58 bp
>AT33746 NZ_AP021916:c40847-40790 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|