Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2460945..2461129 | Replicon | chromosome |
Accession | NZ_AP020324 | ||
Organism | Staphylococcus aureus strain KUN1163 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | KUH140013_RS12435 | Protein ID | WP_000482652.1 |
Coordinates | 2460945..2461052 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2461069..2461129 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KUH140013_RS12410 | 2456307..2456780 | + | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
KUH140013_RS12415 | 2456903..2458114 | - | 1212 | WP_001192073.1 | multidrug effflux MFS transporter | - |
KUH140013_RS12420 | 2458296..2458955 | - | 660 | WP_000831298.1 | membrane protein | - |
KUH140013_RS12425 | 2459015..2460157 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
KUH140013_RS12430 | 2460425..2460811 | + | 387 | WP_000779360.1 | flippase GtxA | - |
KUH140013_RS12435 | 2460945..2461052 | + | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2461069..2461129 | - | 61 | - | - | Antitoxin |
KUH140013_RS12440 | 2461755..2463518 | + | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein/permease | - |
KUH140013_RS12445 | 2463543..2465276 | + | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein/permease | - |
KUH140013_RS12450 | 2465507..2465674 | + | 168 | Protein_2363 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T33351 WP_000482652.1 NZ_AP020324:2460945-2461052 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T33351 NZ_AP020324:2460945-2461052 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT33351 NZ_AP020324:c2461129-2461069 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|