Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 200593..200775 | Replicon | chromosome |
Accession | NZ_AP020318 | ||
Organism | Staphylococcus aureus strain KUH180038 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | F6Y16_RS01245 | Protein ID | WP_001801861.1 |
Coordinates | 200680..200775 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 200593..200652 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
F6Y16_RS01230 | 199731..200108 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
F6Y16_RS01235 | 200302..200478 | + | 177 | Protein_194 | transposase | - |
F6Y16_RS01240 | 200456..200557 | - | 102 | WP_001791893.1 | hypothetical protein | - |
- | 200593..200652 | + | 60 | - | - | Antitoxin |
F6Y16_RS01245 | 200680..200775 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
F6Y16_RS01255 | 200978..201121 | + | 144 | WP_001549059.1 | transposase | - |
F6Y16_RS01265 | 201725..202108 | + | 384 | WP_000070811.1 | hypothetical protein | - |
F6Y16_RS01270 | 202119..202295 | + | 177 | WP_000375476.1 | hypothetical protein | - |
F6Y16_RS01275 | 202297..202482 | + | 186 | WP_000809857.1 | hypothetical protein | - |
F6Y16_RS01280 | 202596..203237 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
F6Y16_RS01285 | 203455..204006 | - | 552 | WP_000414205.1 | hypothetical protein | - |
F6Y16_RS01290 | 204104..204448 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
F6Y16_RS01295 | 204489..205115 | - | 627 | WP_000669046.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T33281 WP_001801861.1 NZ_AP020318:c200775-200680 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T33281 NZ_AP020318:c200775-200680 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT33281 NZ_AP020318:200593-200652 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|