Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2319043..2319227 | Replicon | chromosome |
Accession | NZ_AP020316 | ||
Organism | Staphylococcus aureus strain KUH140331 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | F6Y18_RS11515 | Protein ID | WP_072467491.1 |
Coordinates | 2319043..2319150 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2319167..2319227 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
F6Y18_RS11490 | 2314416..2314889 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
F6Y18_RS11495 | 2315012..2316223 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
F6Y18_RS11500 | 2316405..2317064 | - | 660 | WP_000831298.1 | membrane protein | - |
F6Y18_RS11505 | 2317124..2318266 | - | 1143 | WP_001176873.1 | glycerate kinase | - |
F6Y18_RS11510 | 2318523..2318909 | + | 387 | WP_000779348.1 | flippase GtxA | - |
F6Y18_RS11515 | 2319043..2319150 | + | 108 | WP_072467491.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2319167..2319227 | - | 61 | - | - | Antitoxin |
F6Y18_RS11520 | 2319740..2321503 | + | 1764 | WP_001064834.1 | ABC transporter ATP-binding protein/permease | - |
F6Y18_RS11525 | 2321528..2323261 | + | 1734 | WP_000486502.1 | ABC transporter ATP-binding protein/permease | - |
F6Y18_RS11530 | 2323492..2323659 | + | 168 | WP_031866196.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3944.67 Da Isoelectric Point: 10.4934
>T33267 WP_072467491.1 NZ_AP020316:2319043-2319150 [Staphylococcus aureus]
IFNLLIDIMTSAISGCLVAFFANWLRTRSNKKGDK
IFNLLIDIMTSAISGCLVAFFANWLRTRSNKKGDK
Download Length: 108 bp
>T33267 NZ_AP020316:2319043-2319150 [Staphylococcus aureus]
ATCTTCAATTTATTAATTGACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCAAATTGGTTACGAAC
GCGCAGCAATAAAAAAGGTGACAAATAA
ATCTTCAATTTATTAATTGACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCAAATTGGTTACGAAC
GCGCAGCAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT33267 NZ_AP020316:c2319227-2319167 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|