Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 166143..166323 | Replicon | chromosome |
Accession | NZ_AP020316 | ||
Organism | Staphylococcus aureus strain KUH140331 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | F6Y18_RS01080 | Protein ID | WP_001801861.1 |
Coordinates | 166228..166323 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 166143..166200 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
F6Y18_RS01050 | 162494..163612 | + | 1119 | WP_000072558.1 | restriction endonuclease subunit S | - |
F6Y18_RS01055 | 164260..164703 | + | 444 | WP_000742594.1 | DUF1433 domain-containing protein | - |
F6Y18_RS01060 | 164913..165260 | + | 348 | WP_001566695.1 | DUF1433 domain-containing protein | - |
F6Y18_RS01065 | 165282..165656 | + | 375 | WP_000695818.1 | DUF1433 domain-containing protein | - |
F6Y18_RS01070 | 165844..166026 | + | 183 | Protein_166 | transposase | - |
F6Y18_RS01075 | 166004..166105 | - | 102 | WP_001791232.1 | hypothetical protein | - |
- | 166143..166200 | + | 58 | - | - | Antitoxin |
F6Y18_RS01080 | 166228..166323 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
F6Y18_RS01090 | 166775..167221 | + | 447 | WP_000747802.1 | DUF1433 domain-containing protein | - |
F6Y18_RS01095 | 167906..168289 | + | 384 | WP_000070811.1 | hypothetical protein | - |
F6Y18_RS01100 | 168300..168476 | + | 177 | WP_000375476.1 | hypothetical protein | - |
F6Y18_RS01110 | 168847..169404 | + | 558 | WP_000864138.1 | ImmA/IrrE family metallo-endopeptidase | - |
F6Y18_RS13915 | 169602..170174 | - | 573 | Protein_173 | hypothetical protein | - |
F6Y18_RS01115 | 170275..170616 | - | 342 | WP_000627548.1 | DUF3969 family protein | - |
F6Y18_RS01120 | 170657..171283 | - | 627 | WP_000669019.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | hlgA / lukD | 144606..192141 | 47535 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T33263 WP_001801861.1 NZ_AP020316:c166323-166228 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T33263 NZ_AP020316:c166323-166228 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT33263 NZ_AP020316:166143-166200 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|