Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2379609..2379793 | Replicon | chromosome |
Accession | NZ_AP020313 | ||
Organism | Staphylococcus aureus strain KUH140046 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | F6Y15_RS11955 | Protein ID | WP_000482650.1 |
Coordinates | 2379609..2379716 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2379733..2379793 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
F6Y15_RS11930 | 2374972..2375445 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
F6Y15_RS11935 | 2375568..2376779 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
F6Y15_RS11940 | 2376961..2377620 | - | 660 | WP_000831298.1 | membrane protein | - |
F6Y15_RS11945 | 2377680..2378822 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
F6Y15_RS11950 | 2379090..2379476 | + | 387 | WP_000779358.1 | flippase GtxA | - |
F6Y15_RS11955 | 2379609..2379716 | + | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2379733..2379793 | - | 61 | - | - | Antitoxin |
F6Y15_RS11960 | 2380344..2382107 | + | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein/permease | - |
F6Y15_RS11965 | 2382132..2383865 | + | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
F6Y15_RS11970 | 2384096..2384263 | + | 168 | WP_001790576.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T33250 WP_000482650.1 NZ_AP020313:2379609-2379716 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T33250 NZ_AP020313:2379609-2379716 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT33250 NZ_AP020313:c2379793-2379733 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|