Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 202159..202341 | Replicon | chromosome |
| Accession | NZ_AP020313 | ||
| Organism | Staphylococcus aureus strain KUH140046 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | F6Y15_RS01255 | Protein ID | WP_001801861.1 |
| Coordinates | 202246..202341 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 202159..202218 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| F6Y15_RS01240 | 201297..201674 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| F6Y15_RS01245 | 201868..202044 | + | 177 | Protein_198 | transposase | - |
| F6Y15_RS01250 | 202022..202123 | - | 102 | WP_001791893.1 | hypothetical protein | - |
| - | 202159..202218 | + | 60 | - | - | Antitoxin |
| F6Y15_RS01255 | 202246..202341 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| F6Y15_RS01265 | 202544..202687 | + | 144 | WP_001549059.1 | transposase | - |
| F6Y15_RS01275 | 203291..203674 | + | 384 | WP_000070811.1 | hypothetical protein | - |
| F6Y15_RS01280 | 203685..203861 | + | 177 | WP_000375476.1 | hypothetical protein | - |
| F6Y15_RS01285 | 203863..204048 | + | 186 | WP_000809857.1 | hypothetical protein | - |
| F6Y15_RS01290 | 204162..204803 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| F6Y15_RS01295 | 205021..205572 | - | 552 | WP_000414205.1 | hypothetical protein | - |
| F6Y15_RS01300 | 205670..206014 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
| F6Y15_RS01305 | 206055..206681 | - | 627 | WP_000669046.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 183644..229110 | 45466 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T33245 WP_001801861.1 NZ_AP020313:c202341-202246 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T33245 NZ_AP020313:c202341-202246 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT33245 NZ_AP020313:202159-202218 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|