Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2359320..2359504 | Replicon | chromosome |
Accession | NZ_AP020311 | ||
Organism | Staphylococcus aureus strain KUH140013 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | F6Y13_RS11845 | Protein ID | WP_000482650.1 |
Coordinates | 2359320..2359427 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2359444..2359504 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
F6Y13_RS11820 | 2354683..2355156 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
F6Y13_RS11825 | 2355279..2356490 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
F6Y13_RS11830 | 2356672..2357331 | - | 660 | WP_000831298.1 | membrane protein | - |
F6Y13_RS11835 | 2357391..2358533 | - | 1143 | WP_001176862.1 | glycerate kinase | - |
F6Y13_RS11840 | 2358801..2359187 | + | 387 | WP_000779358.1 | flippase GtxA | - |
F6Y13_RS11845 | 2359320..2359427 | + | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2359444..2359504 | - | 61 | - | - | Antitoxin |
F6Y13_RS11850 | 2360055..2361818 | + | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein/permease | - |
F6Y13_RS11855 | 2361843..2363576 | + | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
F6Y13_RS11860 | 2363807..2363974 | + | 168 | WP_001790576.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T33232 WP_000482650.1 NZ_AP020311:2359320-2359427 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T33232 NZ_AP020311:2359320-2359427 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT33232 NZ_AP020311:c2359504-2359444 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|