Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 186457..186639 | Replicon | chromosome |
Accession | NZ_AP020311 | ||
Organism | Staphylococcus aureus strain KUH140013 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | F6Y13_RS01170 | Protein ID | WP_001801861.1 |
Coordinates | 186544..186639 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 186457..186516 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
F6Y13_RS01155 | 185595..185972 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
F6Y13_RS01160 | 186166..186342 | + | 177 | Protein_179 | transposase | - |
F6Y13_RS01165 | 186320..186421 | - | 102 | WP_001791893.1 | hypothetical protein | - |
- | 186457..186516 | + | 60 | - | - | Antitoxin |
F6Y13_RS01170 | 186544..186639 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
F6Y13_RS01180 | 186842..186985 | + | 144 | WP_001549059.1 | transposase | - |
F6Y13_RS01190 | 187589..187972 | + | 384 | WP_000070811.1 | hypothetical protein | - |
F6Y13_RS01195 | 187983..188159 | + | 177 | WP_000375476.1 | hypothetical protein | - |
F6Y13_RS01200 | 188161..188346 | + | 186 | WP_000809857.1 | hypothetical protein | - |
F6Y13_RS01205 | 188460..189101 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
F6Y13_RS01210 | 189319..189870 | - | 552 | WP_000414205.1 | hypothetical protein | - |
F6Y13_RS01215 | 189968..190312 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
F6Y13_RS01220 | 190353..190979 | - | 627 | WP_000669046.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | hlgA / lukD | 155111..224080 | 68969 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T33227 WP_001801861.1 NZ_AP020311:c186639-186544 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T33227 NZ_AP020311:c186639-186544 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT33227 NZ_AP020311:186457-186516 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|