Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-SprA2AS/- |
| Location | 2554381..2554539 | Replicon | chromosome |
| Accession | NZ_AP019698 | ||
| Organism | Staphylococcus arlettae strain P2 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | SAP2_RS12345 | Protein ID | WP_107373825.1 |
| Coordinates | 2554444..2554539 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2554381..2554417 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAP2_RS12310 | 2549891..2550451 | - | 561 | WP_142020016.1 | TIGR00730 family Rossman fold protein | - |
| SAP2_RS12315 | 2550453..2550980 | - | 528 | WP_142020018.1 | DNA topology modulation protein | - |
| SAP2_RS12320 | 2551141..2551683 | + | 543 | WP_107376750.1 | GNAT family N-acetyltransferase | - |
| SAP2_RS12325 | 2552078..2552491 | + | 414 | WP_100218103.1 | LytTR family transcriptional regulator | - |
| SAP2_RS12330 | 2552488..2552946 | + | 459 | WP_142020020.1 | DUF3021 domain-containing protein | - |
| SAP2_RS12335 | 2552952..2553410 | + | 459 | WP_142020022.1 | DUF4188 domain-containing protein | - |
| SAP2_RS12340 | 2553936..2554277 | + | 342 | WP_172604834.1 | hypothetical protein | - |
| - | 2554381..2554417 | + | 37 | - | - | Antitoxin |
| SAP2_RS12345 | 2554444..2554539 | - | 96 | WP_107373825.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| SAP2_RS12350 | 2554874..2555287 | + | 414 | WP_142020024.1 | hypothetical protein | - |
| SAP2_RS12355 | 2555303..2555536 | + | 234 | WP_142020026.1 | NYN domain-containing protein | - |
| SAP2_RS12360 | 2555592..2555834 | - | 243 | WP_002464877.1 | 30S ribosomal protein S18 | - |
| SAP2_RS12365 | 2556108..2556803 | - | 696 | WP_002509646.1 | thioesterase II family protein | - |
| SAP2_RS12370 | 2556816..2557448 | - | 633 | WP_002509647.1 | 4'-phosphopantetheinyl transferase superfamily protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3537.27 Da Isoelectric Point: 9.9256
>T32909 WP_107373825.1 NZ_AP019698:c2554539-2554444 [Staphylococcus arlettae]
VILIFVHIIGPVISGCAIAYFTYWLSKRNKN
VILIFVHIIGPVISGCAIAYFTYWLSKRNKN
Download Length: 96 bp
>T32909 NZ_AP019698:c2554539-2554444 [Staphylococcus arlettae]
GTGATACTTATTTTCGTTCACATCATAGGGCCAGTCATTAGTGGCTGTGCCATCGCGTACTTTACTTATTGGCTAAGTAA
ACGCAATAAAAACTAG
GTGATACTTATTTTCGTTCACATCATAGGGCCAGTCATTAGTGGCTGTGCCATCGCGTACTTTACTTATTGGCTAAGTAA
ACGCAATAAAAACTAG
Antitoxin
Download Length: 37 bp
>AT32909 NZ_AP019698:2554381-2554417 [Staphylococcus arlettae]
ATACACCAATCCCCTCACTACTGCCATAGTGAGGGGA
ATACACCAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|