Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1936246..1936426 | Replicon | chromosome |
| Accession | NZ_AP019545 | ||
| Organism | Staphylococcus aureus strain KG-22 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | GDK20_RS09490 | Protein ID | WP_001801861.1 |
| Coordinates | 1936246..1936341 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1936369..1936426 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GDK20_RS09460 | 1931409..1932059 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
| GDK20_RS09465 | 1932140..1933135 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| GDK20_RS09470 | 1933210..1933836 | + | 627 | WP_000669024.1 | hypothetical protein | - |
| GDK20_RS09475 | 1933877..1934218 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| GDK20_RS09480 | 1934319..1934891 | + | 573 | WP_000414216.1 | hypothetical protein | - |
| GDK20_RS09485 | 1935089..1936101 | - | 1013 | Protein_1827 | IS3 family transposase | - |
| GDK20_RS09490 | 1936246..1936341 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1936369..1936426 | - | 58 | - | - | Antitoxin |
| GDK20_RS09495 | 1936464..1936565 | + | 102 | WP_001792025.1 | hypothetical protein | - |
| GDK20_RS09500 | 1936543..1936704 | - | 162 | Protein_1830 | transposase | - |
| GDK20_RS09505 | 1936695..1937189 | - | 495 | Protein_1831 | transposase | - |
| GDK20_RS09510 | 1937641..1938870 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| GDK20_RS09515 | 1938863..1940419 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| GDK20_RS09520 | 1940583..1940717 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | tet(M) | lukD / hlgA / selk | 1898436..1981029 | 82593 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T32740 WP_001801861.1 NZ_AP019545:1936246-1936341 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T32740 NZ_AP019545:1936246-1936341 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT32740 NZ_AP019545:c1936426-1936369 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|