Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2583034..2583218 | Replicon | chromosome |
Accession | NZ_AP019542 | ||
Organism | Staphylococcus aureus strain KG-03 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | GDK21_RS13240 | Protein ID | WP_000482652.1 |
Coordinates | 2583111..2583218 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2583034..2583094 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GDK21_RS13225 | 2578489..2578656 | - | 168 | Protein_2496 | hypothetical protein | - |
GDK21_RS13230 | 2578887..2580620 | - | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein/permease | - |
GDK21_RS13235 | 2580645..2582408 | - | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein/permease | - |
- | 2583034..2583094 | + | 61 | - | - | Antitoxin |
GDK21_RS13240 | 2583111..2583218 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
GDK21_RS13245 | 2583352..2583738 | - | 387 | WP_000779360.1 | flippase GtxA | - |
GDK21_RS13250 | 2584006..2585148 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
GDK21_RS13255 | 2585208..2585867 | + | 660 | WP_000831298.1 | membrane protein | - |
GDK21_RS13260 | 2586049..2587260 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
GDK21_RS13265 | 2587383..2587856 | - | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T32710 WP_000482652.1 NZ_AP019542:c2583218-2583111 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T32710 NZ_AP019542:c2583218-2583111 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT32710 NZ_AP019542:2583034-2583094 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|